KEGG   Streptomyces venezuelae: SVEN_6377Help
Entry
SVEN_6377         CDS       T02274                                 

Definition
(GenBank) hypothetical protein
Organism
sve  Streptomyces venezuelae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: CCA59663
UniProt: F2REX8
Position
6963545..6964738
Genome map
AA seq 397 aa AA seqDB search
MRFRHPDGSTVHLAYCTNVHPAETLDGVLAQLRDHCEPVRRRLGRDRLGIGLWLARDAAR
TLTTDPASLRALRAALDRRGLEVVTLNGFPYEGFGADEVKYRVYRPDWTSPERLAHTTDL
ARLLAALLPEDVTEGSVSTLPLAWRTPFDAAAAATARASLTTLAGRLDALEELTGRSIRI
GLEPEPGCTVETVADAVAALADVPSPRIGVCLDTCHLATSFEDPRTALDSLAAAGIPVPK
AQLSAALHAEHPHLPEVKAALAAFAEPRFLHQTRTRTAAGLRGTDDLPEAFATSDALITT
TPGLPDATPWRAHFHVPLHAPPAPPLSSTLPVLTETLGLLVGGPHPRTRHLEVETYTWQA
LPPDRRPRTRARLADGIAAELTLARDLLTDLGLKELP
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttccggcaccccgacggctccaccgtccacctcgcctactgcaccaacgtgcac
cccgccgagaccctcgacggcgtcctcgcccagctccgcgaccactgcgaaccggtccgc
cgccgcctcggccgcgaccgcctcggcatcggactctggctcgccagggacgccgcgcgc
accctgaccaccgaccccgcctcgctccgcgccctgcgcgccgcactcgaccgccgcggc
ctcgaagtggtcaccctgaacggcttcccgtacgaaggcttcggtgccgacgaggtaaag
taccgcgtctaccggcccgactggacgagccccgaacgcctcgcccacaccaccgacctg
gcccggctcctcgccgcgctgctccccgaggacgtcaccgaggggtccgtctccaccctg
cccctcgcctggcgcaccccgttcgacgcggcggccgccgccaccgcccgtgcctcgctg
accacgctcgccggacggctcgacgcgctcgaggagctcaccgggaggagcatccggatc
gggctcgaacccgagccgggctgcacggtcgagaccgtcgccgacgcggtcgccgccctc
gccgacgtaccgagcccccggatcggcgtctgcctggacacctgccatctcgcgacctcc
ttcgaggatccgcgcaccgccctggactccctggcggccgccggcatcccggtgcccaag
gcccagctgtccgcggcgctccacgccgagcacccccacctccccgaggtgaaggccgcg
ctcgccgccttcgccgaaccccgcttcctccaccagacccgtaccaggacggcggccggc
ctgcgcggcaccgacgacctccccgaagccttcgccacgtccgacgccctgatcaccacc
acccccggactgccggacgccacgccctggcgcgcccacttccacgtcccgctgcacgct
ccacccgcccctccgctcagctccacgctccccgtcctgacggagaccctcggtctcctc
gtcggcggcccgcacccgcggacccggcacctggaggtcgagacgtacacctggcaggcc
ctgcctcccgaccggcggccccgcacccgggcccggctcgccgacggcatcgccgccgaa
ctgaccctggcccgcgatctgctgaccgacctcggcctcaaggaactgccatga

DBGET integrated database retrieval system