KEGG   Streptomyces venezuelae: SVEN_6378Help
Entry
SVEN_6378         CDS       T02274                                 

Definition
(GenBank) hypothetical protein
Organism
sve  Streptomyces venezuelae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphodiest Sulfatase
Motif
Other DBs
NCBI-ProteinID: CCA59664
UniProt: F2REX9
Position
6964735..6966144
Genome map
AA seq 469 aa AA seqDB search
MSDPAPVSAPAPTPLLVLDVVGLTPRLLPHMPHLSALARSGSQAPLSTVLPAVTCTAQTT
FLTGTLPAEHGIVGNGWYFRDLGDVLLWRQHNGLVSGDRLWDAARRTHPGYTVANICWWY
AMGADTDITVTPRPVYYADGRKEPDCYTRPPALHDELTEKFGTFPLFHFWGPGADLVSSR
WIVDATRHILRTRRPDLALCYVPHLDYDLQRFGPDDPRSFRAAAALDTVLAPLLAEARAE
GRTVVVLSEYGITRVDRPVDINRALRRAGLLEVHTQDGMEYLDPMTSRAFAVADHQIAHV
YVRRPTDLPAVREALADLPGLERLLDDAGKKEHGLDHPRSGELVALAEPDSWFTYYYWLD
DARAPDFARLVEIHRKPGYDPAELLMDPLDPYVRVKAARELARKKLGMRYRLAVVPLDPS
PLRGSHGRLPASVDSPDGPLILCSTPRALDGRVAATDVKNLLLRLAGVD
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccccgcccccgtgtccgcacccgcacccacccccctcctggtcctcgacgtc
gtcggtctcaccccacggctgctgccgcacatgccccacctgtcggccctcgcccgcagc
ggctcccaggccccgctgtccaccgtcctccccgccgtcacctgcacggcgcagaccacc
ttcctcaccggcaccctccccgccgagcacggcatcgtcggcaacggctggtacttccgg
gacctcggcgacgtcctgctgtggcgccagcacaacggcctcgtctccggcgaccgcctc
tgggacgccgcccgccgcacccaccccggctacaccgtcgccaacatctgctggtggtac
gcgatgggcgccgacaccgacatcaccgtcaccccgcgccccgtctactacgccgacggc
cgcaaggaacccgactgctacacccggccgccggccctgcacgacgaactcaccgagaag
ttcggcacgttccccctgttccacttctggggacccggcgccgacctcgtctccagccgc
tggatcgtcgacgccacccgccacatcctgcgcacccgccgccccgacctcgccctctgc
tacgtcccgcacctcgactacgacctccagcgcttcggcccggacgacccgcgctccttc
cgcgccgccgccgcgctcgacaccgtcctcgccccgctcctcgccgaggcgcgagccgag
ggacgcaccgtcgtcgtcctctccgagtacggcatcacccgggtcgaccggcccgtggac
atcaaccgcgccctgcgccgggccggcctcctggaggtccacacccaggacggcatggag
tacctggacccgatgacctcccgggccttcgccgtcgccgaccaccagatcgcccacgtc
tacgtccggcgccccaccgacctgccggccgtccgggaagccctcgcggaccttccgggt
ctggagaggctcctcgacgacgccggcaagaaggaacacggcctcgaccacccgcgctcg
ggggagctggtcgccctcgccgagcccgactcctggttcacgtactactactggctcgac
gacgcccgcgcccccgacttcgcacggctcgtggagatccaccgcaagcccggctacgac
cccgccgaactcctcatggacccgctcgacccctacgtacgggtcaaggcggccagggag
ctcgcgcggaagaagctcggtatgaggtaccggctcgcggtcgtcccgctcgacccctca
cccctccgcggcagccacggccgcctccccgcgagcgtcgacagtcccgacggtccgctc
atcctgtgctccaccccccgcgccctggacggccgcgtcgcggccaccgatgtgaagaac
ctgctgctcaggctggccggagtcgactga

DBGET integrated database retrieval system