KEGG   Streptomyces venezuelae: SVEN_6383Help
Entry
SVEN_6383         CDS       T02274                                 

Definition
(GenBank) putative regulatory protein
Organism
sve  Streptomyces venezuelae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c_2 HATPase_c
Motif
Other DBs
NCBI-ProteinID: CCA59669
UniProt: F2REY4
Position
complement(6969325..6969756)
Genome map
AA seq 143 aa AA seqDB search
MAQRPQPQTDPVRRFAFELPALTGSVARARRLAEERLILWGCGPDIRDTVALVVSELVTN
AVVHTASDRFICELREGEDTLRISVRDEGGPAGPRIRDCGEEERGRGLLIVDAVCTAWGA
DRTGHGTAQIVWAELAHGMGEPC
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggcccagcgcccgcagccgcagaccgatcccgtgcgccgcttcgccttcgagctcccc
gccctcaccggctcggtcgcccgcgcccgcagactcgccgaggaacgcctcatcctctgg
ggctgcggacccgacatccgcgacaccgtcgccctggtcgtctccgaactcgtcaccaac
gccgtcgtccacaccgccagcgaccgcttcatatgcgaactgcgcgagggcgaggacacg
ctccgcatatccgtccgcgacgaaggcggccccgcgggaccccggatacgcgactgcggc
gaggaggaacgcggccgcggactcctcatcgtcgacgccgtctgcaccgcctggggcgcc
gaccgcaccggccacggcacggcgcagatcgtctgggcggaactggcccacggcatgggg
gaaccgtgctga

DBGET integrated database retrieval system