KEGG   Streptomyces venezuelae: SVEN_6384Help
Entry
SVEN_6384         CDS       T02274                                 

Definition
(GenBank) putative DNA-binding protein
Organism
sve  Streptomyces venezuelae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_31 HTH_3 HTH_25 HTH_37 HTH_23 TnsD HTH_19
Motif
Other DBs
NCBI-ProteinID: CCA59670
UniProt: F2REY5
Position
6970019..6970894
Genome map
AA seq 291 aa AA seqDB search
MSEPRSAPTVGQVVLGRRLQDLRERAGLKREEAAKVLRVAPATVRRMETAEVALKIPYVQ
LLLREYGITDSEAEGFIALAEEANLPGWWQRFHDVLPGWFSMYVSLEGAASLIRAYEPQF
VPGLLQTEDYARAILRSGAVGGGSDAGKDEDAERHVALRMERQSLLTREDAPKFWVIMDE
TVFRRPVGDGPEVMRDQLDRLLEASELPNVTLQIAEFASGHHPGTYGPFVLFRFAMPELP
DMVYSEYLTGAVYLDARPEVASHLEVMDRMAAQAATAQRTKEILRNLRKEL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagccgcggtccgcccccacggtgggacaggtcgttctcggcaggcgcctgcag
gatctgcgggagcgggccggcctgaagagggaagaggccgcgaaggtcctccgggtcgcc
ccggccaccgtccggcggatggagaccgccgaggtcgcgctgaagattccgtacgtgcag
ctcctgttgagggagtacgggatcacggactccgaggcggagggcttcatcgccctcgcg
gaggaggccaacctccccggctggtggcagcggttccacgacgtgctgcccggctggttc
tccatgtacgtgagcctggagggggccgcgagcctcatccgggcctatgagccccagttc
gtccccggtctgctccagaccgaggactacgcccgcgccattctgcgcagcggggcggtc
ggtggcggcagcgatgccggcaaggacgaggacgccgaacggcatgtagccctacggatg
gagcgccagtccctgctcaccagggaggacgccccgaagttctgggtgatcatggacgag
acggtgttccgccgaccggtcggtgacgggcccgaagtgatgcgcgaccagctcgaccgg
ctgctcgaagcgtcggagctgccgaacgtcaccctgcagatcgcggagttcgcgtccggc
caccatcccggcacctacggaccgttcgtcctcttccgcttcgccatgcccgaacttccg
gacatggtctacagcgagtacctgaccggcgccgtctatctcgacgcgcgccccgaggtg
gcatcccacctggaggtcatggaccgcatggcggctcaggccgcgactgcacaacgcacg
aaggagattctccggaatctccgcaaggagctgtga

DBGET integrated database retrieval system