KEGG   Streptomyces venezuelae: SVEN_6388Help
Entry
SVEN_6388         CDS       T02274                                 

Definition
(GenBank) Maltose-6-phosphate glucosidase
  KO
K01222  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sve  Streptomyces venezuelae
Pathway
sve00010  Glycolysis / Gluconeogenesis
sve00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:sve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SVEN_6388
   00500 Starch and sucrose metabolism
    SVEN_6388
Enzymes [BR:sve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SVEN_6388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4C Glyco_hydro_4
Motif
Other DBs
NCBI-ProteinID: CCA59674
UniProt: F2REY9
Position
complement(6974091..6975398)
Genome map
AA seq 435 aa AA seqDB search
MPLVYGALLGDHAEGRVTRVTLFDLDEGRLSAIARVLAEQGAGVPDAPVVTATTDLDEAL
RGADFVFSAIRVGGLDGRAADERIALAEGVLGQETVGAGGIAYGLRTVPVAVRIARRIAE
LAPDAWVINFTNPAGLVTEAMSRILGDRVIGICDSPVGLGRRVARILGADPDEAWIDYVG
LNHLGWLRGLRIDGRDELPRLLADEEALNSFEEGRLFGAEWLRSLGAIPNEYLHYYYFNR
EAVQAYRSAERTRGAYLRDQQAGFYQEMGKPDTPALATWHRTLADREATYMAANREAAGI
GERDEEDLESGGYEKVALALMRAVARDERATLILNVRNGTTLAALDADAVIEVPCLVDAN
GAHPLSVSPLPYHAVGLVTAVKAVEREVLAAAESGSRASAVKAFALHPLVDSVTVARRLV
EGYTAEHAGLSYLRH
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
gtgccgctggtgtacggcgctctcctcggcgaccacgccgagggacgggtcacccgcgtc
accctcttcgacctcgacgaggggcggctctcggcgatcgcccgggtcctcgcggagcag
ggcgcgggggtgccggacgcgcccgtggtcacggcgacgacggacctggacgaggccctg
cgcggggcggacttcgtgttctccgcgatccgggtcggcggtctcgacggccgggcggcc
gacgagcggatcgcgctcgccgagggcgtgctcggccaggagacggtgggcgcgggcggc
atcgcgtacgggctgcggaccgtgcccgtggccgtccgcatcgcccgccggatcgccgaa
ctcgccccggacgcctgggtcatcaacttcaccaaccccgcgggtctggtcaccgaggcg
atgtcgcggatcctcggtgaccgggtcatcggcatctgcgactccccggtgggcctcggc
cgccgggtcgcccgcatcctgggcgcagacccggacgaggcctggatcgactacgtgggc
ctcaaccacctgggctggctgagggggttgcggatcgacggccgggacgaactgccccgg
ctgctcgccgacgaggaggcgctgaactccttcgaggagggccggctgttcggcgcggag
tggctgcgctcgctgggcgcgatccccaacgagtacctgcactactactacttcaaccgg
gaggccgtacaggcctaccggagcgccgagcggacccgcggcgcctacctccgcgaccaa
caggccggtttctaccaggagatgggcaagccggacacgcccgccctggccacctggcac
cggacgctcgccgacagggaggccacctacatggcggccaaccgggaggcggccgggatc
ggggagcgcgacgaggaggacctggagtcgggcggttacgagaaggtggcgctcgccctc
atgcgggccgtcgcccgggacgagcgggccacgctgatcctcaacgtccgcaacggcacg
acgctcgccgcgctcgacgcggacgcggtgatcgaggtgccctgcctcgtcgacgcgaac
ggcgcccacccgctgtcggtgtcccccctcccgtaccacgcggtcggcctggtgaccgcg
gtgaaggcggtggaacgggaggtgctcgcggcagccgagagcggctctcgggcgagcgcc
gtcaaggccttcgcgctccatccgctggtcgactcggtgacggtggcccgccgcctggtg
gagggctacacggccgagcacgcgggtctttcgtacctacgccactga

DBGET integrated database retrieval system