KEGG   Streptomyces venezuelae: SVEN_6391Help
Entry
SVEN_6391         CDS       T02274                                 

Definition
(GenBank) Multidrug resistance protein B
Organism
sve  Streptomyces venezuelae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 TRI12 Sugar_tr OATP
Motif
Other DBs
NCBI-ProteinID: CCA59677
UniProt: F2REZ2
Position
complement(6976054..6978165)
Genome map
AA seq 703 aa AA seqDB search
MTTTSDAAPAPPAAEPPVLDSRRRNIVFGTIMLGVLLAALDQTIVGTALPTIVSDLGGAA
HMSWVVTSYLLAETVATVLVGKFGDLFGRKVIFQISAVVFITGSFLCGLATNMTLLIVWR
GLQGIGAGGLMVTSMALIADVIPLRERGKYQGAIGAVFGVSTVIGPLLGGLFTDHLTWRW
AFYVNVPIAILVVIAAARTIPSLRSASKPVIDYAGIALVAAGSSALILATSWGGNEYAWG
SGVIIGLFAGGIVALALFCWVETRAAEPMLPMRLFGNPVFTVCSVLSFVVGFAMLGAMTF
LPTYLQYVDGDSATVSGIRTLPMVIGLLIASIFSGNVVSKTGHYRIFPILGCLVMGLGLY
LLSLMGPETSAWLASLYMFVLGVGIGLCMQVLTIAVQNTVDYADLGTATSGVTFFRTLGS
SFGTAVFGTIYVNSLTPNLKTGVAEASAVAGSQGLDPAAVARAAQSPDGVHGLPEQVAEP
IVNAYADTLHTVFLWTVPVAAVGFVVALFLKQVTLRDSARAAAPDMGEGFSSPTSSGDSA
QHLELAVGRIMRRIDLATARRILDTSDTRLDTAGAWAVMQVELYTRTVGHASLGLISAGR
RVPPEVLLPVFDRMVDEGFLTRDGHLLSHTPAGKREADVITHAWGDWLSDRVEQEIGRPS
GPELRMATDAIAKKVVAEDLANGLPDRSLDRDGGRALTRTTGG
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacgaccagcgacgcagcgcccgcgccccccgccgccgagccccccgtgctcgac
agccgccgccgcaacatcgtcttcggcacgatcatgctgggtgtcctcctcgccgccctc
gaccagacgatcgtcggcaccgcactgcccacgatcgtctcggacctcggcggcgccgcc
cacatgtcgtgggtggtcacctcgtacctgctcgcggagacggtcgcgaccgtcctcgtc
ggcaagttcggcgatctcttcggccgcaaggtgatcttccagatctcggccgtcgtgttc
atcaccggctcgttcctctgcggactggccaccaacatgacgctgctgatcgtctggcgc
ggactccagggcatcggcgcgggcgggctcatggtcacctcgatggcgctcatcgccgat
gtgatcccgctgcgcgaacgcggcaagtaccagggcgcgatcggcgccgtgttcggcgtc
tccaccgtcatcggcccgctcctcggcggcctgttcaccgaccacctgacctggcgctgg
gcgttctacgtgaacgtccccatcgcgatcctcgtcgtcatcgccgccgcccgcacgatc
ccctccctacgctcggcgagcaagccggtcatcgactacgcgggcatcgcgctcgtcgcc
gccggatcgagcgccctgatcctggcgaccagttggggcggcaacgagtacgcctggggt
tccggcgtcatcatcggcctcttcgccggcgggatcgtcgccctcgccctgttctgctgg
gtcgagacccgcgcggccgaacccatgctgccgatgcggctgttcggcaatccggtcttc
accgtgtgctccgtgctgagcttcgtcgtcggcttcgcgatgctcggcgcgatgacgttc
ctgccgacctacctccagtacgtcgacggggactcggccaccgtctccggcatccgcacc
ctccccatggtcatcggcctgctcatcgcctccatcttcagcggcaacgtggtcagcaag
acgggccactaccggatcttcccgatcctcggctgtctggtgatggggctcggcctctat
ctgctgtccctcatgggaccggagaccagcgcctggctcgcctcgctgtacatgttcgtg
ctgggcgtcggcatcggcctgtgcatgcaggtcctcaccatcgccgtgcagaacaccgtc
gactacgccgacctcggcaccgccacctccggcgtcaccttcttccgtacgctcggcagc
tccttcggcaccgccgtcttcggcacgatctacgtcaactccctcacgcccaacctcaag
accggcgtcgccgaggcctccgccgtggccgggagccaggggctggacccggcggccgtg
gcgcgggcggcgcagagcccggacggggtgcacgggctgccggagcaggtcgcggagccc
atcgtcaacgcctacgccgacaccctccacaccgtcttcctctggaccgtcccggtcgcc
gccgtcggcttcgtcgtcgcgctcttcctcaagcaggtgacgctccgcgactcggcccgg
gccgccgcacccgacatgggcgagggcttctcctcgccgacctcgtcgggcgactccgca
cagcacctcgaactggccgtgggcaggatcatgcgccggatcgacctcgccaccgcgcgg
cggatcctcgacacctccgacacccggctcgacacggccggggcgtgggcggtcatgcag
gtcgagctgtacacgcggacggtcggccacgcgagcctggggctcatctccgcgggccgg
cgggtcccgcccgaggtgctgctgccggtcttcgaccggatggtcgacgaggggttcctg
acccgcgacgggcatctgctctcccacaccccggccggcaaacgcgaggcggacgtcatc
acgcacgcgtggggcgactggctgtccgaccgcgtcgagcaggagatcggccggcccagc
ggacccgagctgcggatggcgacggacgccatcgccaagaaggtcgtcgccgaggacctc
gcgaacggactccccgaccggtcgctcgaccgcgacggcgggcgcgccctgacccggacg
acgggaggctga

DBGET integrated database retrieval system