KEGG   Streptomyces venezuelae: SVEN_6392Help
Entry
SVEN_6392         CDS       T02274                                 

Definition
(GenBank) hypothetical protein
Organism
sve  Streptomyces venezuelae
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CCA59678
UniProt: F2REZ3
Position
complement(6978263..6978514)
Genome map
AA seq 83 aa AA seqDB search
MITSPSRLVPVPIPDRVAALIGSCLPLHVLQAEIDADCAAREVYRFRGPLCAEDRADREH
ALAALARANKILAKHHPKLPVTP
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
gtgatcacctcgccctcgcgcctcgttcccgtcccgatccccgaccgcgtggccgcgctc
atcggctcctgcctgccgctgcacgtcctccaggccgagatcgacgcggactgcgcggcg
cgcgaggtctaccgcttccgggggccgctctgcgcggaggaccgggcggaccgtgagcac
gcgctcgccgcgctcgcccgcgccaacaagatcctcgccaagcaccacccgaagctgccc
gtcacgccctga

DBGET integrated database retrieval system