KEGG   Streptomyces venezuelae: SVEN_6409Help
Entry
SVEN_6409         CDS       T02274                                 

Definition
(GenBank) putative membrane protein
Organism
sve  Streptomyces venezuelae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sacchrp_dh_NADP Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: CCA59695
UniProt: F2RF10
Position
complement(6991280..6992623)
Genome map
AA seq 447 aa AA seqDB search
MDTGAGVGDGTGAEPPAEEARAATAGAGAPGAEATATDGVGAAGAETAAGASARATDEVR
PYDVVLFGATGFVGTLTAEYLAAHAPAGCRWALAGRNRAGLTALRERLAARWPHCAELPL
VVADAADPGSLGELAESARVVATTVGPYVWYGDGLVAACAEAGTDYLDLTGEAEFVDLTY
VRHDARARETGARIVHACGFDSVPHDLGAYFTVRQLPEGVPLRVDGFVRAGAQFSGGTFA
SALTAFGRGRQILRAAHERRLHEPRLVGRRARAPLGGPRFSRETGTWALPLPTLDPQVVA
RSAAAMERYGPDFRYRHYASVKTLPMALGGAAVVGASALAAQLPPVRDWLMGRYQAGEGP
SAERRARSWFSVRFVGEGGGRRVFTEVSGGDPGYDETAKMLAESALCLAFDALPKTAGQV
TTAAAMGDALIARLTEAGLRFRVAHRS
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggacacaggggcgggcgtgggcgacgggaccggggcggagcccccggccgaggaggca
cgggcggcgaccgccggggccggggcgccgggcgcggaggcgacggcgaccgacggggtc
ggggcggcgggcgcggagacggctgccggggcatcggcccgggcgaccgacgaggtcagg
ccgtacgacgtggtgctgttcggggcgaccggattcgtcggcacgctcaccgccgagtac
ctggcagcacacgccccggccgggtgccgctgggcgctcgccggacgcaaccgggcgggg
ctcacggccctgcgcgagcggctcgccgcccggtggccgcactgcgccgagctgccgctg
gtcgtcgccgacgccgccgaccccggctcgctgggcgaactcgcggagtccgcccgggtg
gtggccaccaccgtcggcccgtacgtctggtacggcgacgggctcgtcgccgcctgcgcg
gaggccggcacggactatctggacctcaccggcgaagccgagttcgtcgacctgacgtac
gtacgccacgacgcgcgggcccgggagaccggtgcccggatcgtgcacgcctgcggcttc
gactccgtcccgcacgacctgggcgcgtacttcaccgtgcggcagctcccggagggcgtg
ccgctgcgggtggacggcttcgtccgggccggggcccagttctccggcggcaccttcgcc
tccgcgctgaccgccttcggccgcggccggcagatcctgcgggccgcgcacgaacggcgg
ctgcacgaaccgcgcctggtgggccgccgggcccgcgcgccgctcggcgggccgcgattc
agccgggagaccggcacctgggcgctgccgctgcccacgctcgacccgcaggtggtcgcc
cgctcggccgcggccatggagcgctacggcccggacttccgctaccggcactacgcctcc
gtgaagaccctgccgatggccctcgggggcgccgcggtggtcggcgcgagcgcgctggcg
gcccaacttccgccggtacgggactggctgatggggcgttaccaggcaggcgagggcccg
tccgccgagcggcgcgcccgcagctggttctccgtccgtttcgtcggcgagggcggcggg
cgacgggtcttcaccgaggtctcgggcggcgatccggggtacgacgagacggccaagatg
ctcgccgagtcggcgctgtgcctcgccttcgacgcgctgccgaagacggcgggccaggtg
acgacggcggcggcgatgggcgacgcgctcatcgcccggctcacggaggcgggcctccgc
ttccgggtcgcccaccggagctga

DBGET integrated database retrieval system