KEGG   Streptomyces venezuelae: SVEN_6415Help
Entry
SVEN_6415         CDS       T02274                                 

Definition
(GenBank) hypothetical protein
Organism
sve  Streptomyces venezuelae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU
Motif
Other DBs
NCBI-ProteinID: CCA59701
UniProt: F2RF16
Position
6999569..7000051
Genome map
AA seq 160 aa AA seqDB search
MYTQLRETADELAGVLWREHTVYRERGGGVVIRGEHVRRWISLGPTGGKDRALLRAGRLL
DGGTTAPARTEVVVDLTAGTAELAAVCRRLLAEVAAAAEPAPVPAGAPRRRKPARAARAA
RAGRPRRERHTSLGSFVVLLCVTGVLGAWLYSLFGGGYGY
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgtacacgcaactcagggagacggccgacgaattggccggtgttctgtggcgggagcac
accgtctaccgggagcggggtggtggtgtggtgatccggggcgagcacgtacggcgctgg
ataagcctcggccccaccggcggcaaggaccgggcgctgctgcgcgcggggcggctgctc
gacggggggacgaccgcccccgcccgtaccgaggtggtggtcgatctgacggccgggacc
gcggagctcgcggcggtctgccgccggctgctcgccgaggtcgccgcggccgccgagccc
gcgcccgtgcccgccggggcgccccgcaggcgaaagccggcccgggcggcgcgtgccgcc
cgggccggcaggccccgcagggagcggcacacgagtctgggttccttcgtcgtgctgctc
tgtgtcaccggggttctcggtgcctggctctacagcctgttcggcggcggatacgggtac
tga

DBGET integrated database retrieval system