KEGG   Streptomyces venezuelae: SVEN_6420Help
Entry
SVEN_6420         CDS       T02274                                 

Definition
(GenBank) hypothetical protein
  KO
K01281  X-Pro dipeptidyl-peptidase [EC:3.4.14.11]
Organism
sve  Streptomyces venezuelae
Brite
KEGG Orthology (KO) [BR:sve00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sve01002]
    SVEN_6420
Enzymes [BR:sve01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.11  Xaa-Pro dipeptidyl-peptidase
     SVEN_6420
Peptidases [BR:sve01002]
 Serine Peptidases
  Family S15
   SVEN_6420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S15 PepX_C Peptidase_S9
Motif
Other DBs
NCBI-ProteinID: CCA59706
UniProt: F2RF21
Position
7004653..7006650
Genome map
AA seq 665 aa AA seqDB search
MAAATAALLATLVTPAGARPDPTAVPAVAQATAGLPVRESRPVHSYADAIRESVWVDTGL
DGDGDGRTDRVAVDIVRPRETAAAGRKIPVIMDASPYYACCGRGNESQKKTYDADGNPVQ
FPLFYDNFFVPRGYAFVAVDLAGTNRSDGCDDVGGRSDIRSAKAVVDWLNGRARGYTSRT
GDARARATTWSTGNVGMIGKSWDGTVANGVAATGVEGLKTIVPIGAISSWYDYFHSQGAP
LYNANPSWLSEYVNSPEAQARCGAVQQRITAGTPYSGDRTPAWAERDYVRNAGKVKASVF
VVHGQQDLNVRANHFGQWWDALGAQGVERKIWLSQTGHVDPFDFRRADWVHTLHRWFDHY
LLGYDNGIDREPMADIERAPDRWTTDRQWPPRATATTTLRPAPGAAAGPGVLGRVPAAPG
STATFTDDPALGELDWAARIDGATPEKAGFVTRPLSRELRLSGSSKVTVTATPTTATAHL
SAVLVDLGPDTIRDYGAAGEGITTLADRTCWGASTPGDSACFKETAARTADVGYTVVSRG
WADLGTWADPAEERPLTPGRAYTMTLDLAAADHVVPAGHRLALIVAGTDKDLLDPPSTTP
TLTLDLTRTWAKLPLVGGAAAFGRATSGAYPAVPSPARTTAPSLSGAVPPVAVSGPRVPG
AGAAR
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
gtggccgcggccacggccgccctgctcgcgaccctggtcacgcccgcaggcgcgcggccg
gacccgacggccgtgcccgccgtggcccaggcgaccgcagggctcccggtgcgggagtcc
cggcccgtccactcgtacgccgacgccatccgcgagtccgtatgggtcgacaccggcctc
gacggcgacggcgacgggcgtacggaccgggtcgccgtcgacatcgtccgcccccgggag
accgcggcggccggccggaagatcccggtcatcatggacgcgagcccctactacgcctgc
tgcggacggggcaacgagagccagaagaagacctacgacgccgacgggaaccccgtccag
ttccccctgttctacgacaacttcttcgtcccccgcggctatgccttcgtcgccgtcgac
ctcgccggcaccaaccgctccgacggctgcgacgacgtcggcggacgctccgacatccgg
tcggccaaggccgtcgtcgactggctgaacggccgcgcccgcggctacacctcccgtacc
ggcgacgcccgcgcccgggccaccacctggtccaccgggaacgtcggcatgatcggcaag
agctgggacggcaccgtcgccaacggcgtcgccgccaccggcgtcgaagggctgaaaacg
atcgtcccgatcggcgccatctcctcctggtacgactacttccactcccagggcgccccc
ctctacaacgccaacccgagctggctctccgagtacgtcaacagccccgaggcgcaggcc
cgctgcggcgccgtccagcagcgcatcaccgcgggaacgccctacagcggcgaccggacg
ccggcctgggccgagcgtgactacgtgcggaacgcgggcaaggtcaaggccagcgtcttc
gtcgtgcacggacagcaggacctcaacgtgcgcgccaaccacttcggccagtggtgggac
gcgctcggcgcccagggcgtcgagcggaagatctggctctcccagaccggccacgtcgac
cccttcgacttccgccgggccgactgggtccacaccctgcaccgctggttcgaccactac
ctcctcggctacgacaacggcatcgaccgcgagccgatggccgacatcgagcgcgccccc
gaccgctggaccaccgaccgccagtggccgccgcgcgccaccgcgaccaccaccctgcgc
cccgcacccggcgcggcggccggccccggtgtgctcggccgcgtccccgcggcccccggc
tccaccgcgaccttcaccgacgacccggccctcggcgaactcgactgggccgcccggatc
gacggcgcgacccccgagaaggccgggttcgtcacccgccccctctcccgtgagctgcgg
ctctccggctcctccaaggtcacggtcaccgccaccccgaccaccgccaccgcccacctc
tccgccgtcctggtcgacctcggacccgacacgatccgcgactacggcgccgccggcgaa
ggcatcaccaccctcgccgaccgcacctgctggggcgcgagcacgcccggtgacagcgcc
tgcttcaaggagaccgcggcccgcacggccgacgtcgggtacacggtcgtcagccggggc
tgggccgacctcgggacctgggccgacccggcggaggagcgcccgctgacccccggcagg
gcgtacacgatgaccctcgacctcgccgccgccgaccacgtcgtcccggccggtcaccgg
ctcgccctgatcgtcgccggtaccgacaaggacctgctcgaccctccgtccaccaccccg
accctcaccctcgacctcacccgcacctgggcgaagctgccgctggtcggcggcgccgcg
gccttcggccgggcgacctccggggcgtacccggccgtgccgtcgcccgcccgcaccacc
gcgccgtccctgagcggagccgtaccgccggtcgcggtcagcggtccgcgcgtccccgga
gcaggagccgcccgatga

DBGET integrated database retrieval system