KEGG   Streptomyces venezuelae: SVEN_6421Help
Entry
SVEN_6421         CDS       T02274                                 

Definition
(GenBank) putative carboxypeptidase
Organism
sve  Streptomyces venezuelae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M14 AstE_AspA DUF2817
Motif
Other DBs
NCBI-ProteinID: CCA59707
UniProt: F2RF22
Position
7006647..7007954
Genome map
AA seq 435 aa AA seqDB search
MIPRTVRRSSRRTLGLVAGAAALALPLVTVPAGPADSATVKPLPRTGFEASGGARWTSEA
EERDFLAAVDRASARVSLRVIGTTAQGRPLRLATLGTGRTTVLLVCSQHGDEPAGREACL
STVRDLAYAKDRETRNLLARTTLLVVPTANPDGREADTRGNADGVDINRDHIALRTAEAR
AVAAVIRDRRPELVYDLHEYGATPRYYDKDLLALWPRSLDTDAHVHDESEKLSERYVRPA
AGLAGYSTGIYGIWTDPLTGKPLKQVAGDGQERILRNTAGIKHSVGLLVETRVDALDEAE
QNDPARNHRRRVATQHAALAGAFAYVEERRGPLTAATAAARRAGYADRGPVFLGGADNDP
PEPAEILADPPCGYRLDAAQYAEAGDELALHGITVRREGEGVFVPMSQSRRSLVPLLLDG
RATYHLVSGSPVEEC
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgatcccccgtaccgtgcgccggagttcacgccgcaccctcggcctggtggccggcgcg
gcggcgctcgccctgccgctcgtcaccgtccccgccgggccggcggacagcgcgacggtg
aaaccgctgccgcgcaccgggttcgaggcgtccggcggcgcccggtggacgagcgaggcc
gaggagcgggacttcctggccgcggtcgaccgggcgagcgcccgggtgtcgctgcgggtc
atcggcaccaccgcgcagggccggccgctgcggctcgccaccctcggcacgggccgcacc
acggtgctgctcgtctgcagccagcacggcgacgagccggccggacgcgaggcctgcctg
agtacggtgcgggacctcgcctacgccaaggaccgggagacccggaacctcctcgcccgg
acgaccctgctcgtcgtccccaccgccaaccccgacggccgggaggccgacacccggggc
aacgccgacggggtcgacatcaaccgggaccacatcgccctgcggaccgccgaggcgcgt
gcggtcgccgccgtcatccgcgaccggcggcccgaactcgtctacgacctgcacgagtac
ggggccaccccccggtactacgacaaggacctgctcgccctctggccgcgcagcctggac
accgacgcgcacgtccacgacgagtccgagaagctctccgagcggtacgtcagacccgcc
gccggactcgccgggtacagcaccggcatctacggcatctggacggacccgctcaccggc
aagccgctcaagcaggtcgcgggcgacggccaggagcgcatcctgcgcaacacggccggc
atcaagcactccgtggggctcctcgtcgagacccgggtggacgcgctcgacgaggccgaa
cagaacgacccggcccgcaaccaccggcgccgggtcgccacccagcacgccgcgctggca
ggggcgttcgcctatgtggaggagcggcgcggcccgctcacggcggccaccgccgccgcc
cggcgcgccgggtacgccgaccggggaccggtcttcctcggcggcgccgacaacgacccg
ccggagcccgcggagatcctcgccgacccgccgtgcggctaccgcctcgacgccgcgcag
tacgccgaggcgggcgacgaactggccctgcacggcatcaccgtgcggcgcgaaggggag
ggcgtgttcgtgccgatgagccagtcgcggcgctcgctcgtcccgctgctcctggacggc
cgtgccacctatcacctcgtcagtgggagtcctgtggaggagtgttga

DBGET integrated database retrieval system