KEGG   Streptomyces venezuelae: SVEN_6428Help
Entry
SVEN_6428         CDS       T02274                                 

Definition
(GenBank) Transcription accessory protein
  KO
K06959  protein Tex
Organism
sve  Streptomyces venezuelae
Brite
KEGG Orthology (KO) [BR:sve00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    SVEN_6428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tex_N Tex_YqgF HHH_3 HHH_9 S1 HHH_7 T2SSK YqgF HHH_6 PCB_OB
Motif
Other DBs
NCBI-ProteinID: CCA59714
UniProt: F2RF29
Position
complement(7012667..7015090)
Genome map
AA seq 807 aa AA seqDB search
MTTSIEARIAEELGVRERQVKAAVELLDGGSTVPFIARYRKEATEMLDDAQLRTLEERLR
YLRELEDRRSAILDSVREQGKLTDELEARIRAADTKARLEDIYLPFKPKRRTKAQIAREA
GLAPLAEGLLADPSVEPAAAAAAFVDADKGVADAAAALEGARAILAETFSEDADLIGELR
ERMWSRGRLVAKVRDGQEEAGAKFADYFDFTEPFTALPSHRVLAMLRGEKEDVLSLELEP
EEPSELPGPSSYEGIVAERFGIADRGRPGDKWLQETVRWAWRTRILVHLGIDLRLRLRTA
AEDEAVRVFAANLRDLLLAAPAGTRATLGLDPGFRTGVKVAVVDATGKVVATDTIYPHVP
ANKWDQALERLARLAKEHAVELIAIGNGTASRETDKLAAELLAKHPELKLTKVMVSEAGA
SVYSASAFASQELPDLDVSLRGAVSIARRLQDPLAELVKIDPKSIGVGQYQHDLAEVKLS
RSLDAVVEDCVNGVGVDVNTASAPLLSRVSGISSGLAENIVAHRDANGPFRSRRALKDVA
RLGPKAYEQCAGFLRIRGGDDPLDSSSVHPEAYPVVRRMVKATGGEVAALIGDTGTLRSL
RPDDFVDETFGLPTVTDILRELEKPGRDPRPAFRTATFAEGVEKIGDLASGMVLEGVVTN
VAAFGAFVDIGVHQDGLVHVSAMSKNFVKDPRDVVKPGDVVKVKVLDVDIPRKRISLTLR
LDDESGTEGQGGAPRRERGERGDRGERAGRPPQQRQGGGRRSEGGNRNERGERGGRERSA
APAPANSAMADALRKAGLLGDGDRKRR
NT seq 2424 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacgtccatcgaagcaaggatcgccgaggaactcggcgtacgcgagcgacaggtg
aaggcagccgtcgagctgctcgacggcggttcgaccgtgccgttcatcgcgcgctaccgc
aaggaagcgaccgagatgctcgacgacgcgcagctgcgcaccctcgaggagcggctgcgc
tatctgcgcgagctggaggaccgccggtcggcgatcctcgactcggtacgcgagcagggc
aagctgacggatgagctggaggcccgcatccgggccgccgacaccaaggcgcgcctggag
gacatctacctgcccttcaagcccaagcgccggacgaaggcccagatcgcccgcgaggcg
gggctcgcacccctggcggaggggctgctcgcagacccgtcggtggagccggcggccgcc
gccgcggccttcgtggacgcggacaagggcgtcgcggacgccgccgcggccctggagggc
gcgcgggcgatcctcgccgagaccttctccgaggacgccgatctcatcggcgagctccgc
gagcgcatgtggagccgcgggcggctggtggcgaaggtgcgggacgggcaggaggaggcc
ggagcgaagttcgccgactacttcgacttcaccgagcccttcacggcgctgccctcgcac
cgggtgctcgccatgctgcgcggcgagaaggaggacgtgctcagcctggaactggagccg
gaggagccctccgagctccccggcccgtcctcgtacgaggggatcgtcgcggagcgcttc
gggatcgccgaccggggccgccccggtgacaagtggctccaggaaacggtccgttgggcc
tggcggacccgcatcctcgtccacctcgggatcgacctgcggctgcggctgcggacggcc
gccgaggacgaggcggtccgggtcttcgcggcgaacctgcgggacctgctgctcgccgca
ccggccggcacccgcgccacgctcggcctcgacccgggcttccgtaccggcgtcaaggtg
gccgtggtcgacgcgaccggcaaggtcgtggccaccgacaccatctacccgcacgtgccg
gccaacaagtgggaccaggcgcttgagaggctggcgcggctcgcgaaggagcacgcggtc
gagctgatcgcgatcgggaacggcacggcctcccgcgaaaccgacaagctggcggccgaa
ctcctcgccaagcaccccgagttgaagctgaccaaggtcatggtctcggaggcgggcgcc
tcggtctactcggcctccgccttcgcctcgcaggaactcccggacctcgacgtgtcgttg
cgcggcgcggtctccatcgcccgccgcctccaggacccgctcgccgagctggtgaagatc
gacccgaagtccatcggcgtcggccagtaccagcacgacctggccgaggtgaagctgtcc
cgctcgctcgacgcggtcgtcgaggactgtgtgaacggtgtcggtgtcgacgtcaacacc
gcctcggcgccgctgctctcccgggtctcgggcatcagctcgggcctcgcggagaacatc
gtggcgcaccgggacgccaacggccccttccgctcccgccgggccctcaaggacgtggcc
aggctcggcccgaaggcgtacgagcagtgcgcgggcttcctgcgcatccggggcggcgac
gacccgctcgactcctcctcggtgcacccggaggcgtacccggtggtgcgccggatggtg
aaggccacgggcggcgaggtggcggcgctcatcggcgacaccggcacgctgcgctcgctg
cggccggacgacttcgtcgacgagaccttcggtctgccgacggtgacggacatcctgcgc
gagctggagaagccgggccgcgacccgcgaccggcgttccgtacggccaccttcgccgag
ggcgtcgagaagatcggcgacctggcgtccgggatggtcctggagggcgtcgtcaccaac
gtggccgcgttcggggcgttcgtggacatcggtgtgcaccaggacggcctggtgcacgtc
tcggcgatgtcgaagaacttcgtcaaggatccgcgtgacgtggtgaagcccggcgacgtg
gtcaaggtgaaagttctcgacgtcgacatcccccgcaagcggatctcgctgacgctgcgg
ctcgacgacgagtcgggcaccgaaggacagggcggggcgccccggcgcgagcggggcgag
cgcggcgatcggggcgagcgcgcgggccggccgccgcagcagcggcagggtggtggccgc
aggtccgagggcggtaaccggaacgagcgcggggagcgtggcggccgggaacgttcggcg
gcgcccgcgcccgccaacagcgccatggcggacgccctgcgcaaggccggcctgctgggc
gacggagaccgcaagcgccgatag

DBGET integrated database retrieval system