KEGG   Streptomyces venezuelae: SVEN_6429Help
Entry
SVEN_6429         CDS       T02274                                 

Definition
(GenBank) hypothetical protein
Organism
sve  Streptomyces venezuelae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD DUF5635
Motif
Other DBs
NCBI-ProteinID: CCA59715
UniProt: F2RF30
Position
complement(7015219..7016088)
Genome map
AA seq 289 aa AA seqDB search
MTTTALPPRAGRRCHNAINPFHSTLYFSPDLDREFGALGFTDRSAMRLAARSAALGAVGA
GTVAATFYNYNHELLAQHLPAVWETASPAAVLDARLRTVDATLRRLLGEETVASPEMAEA
AELALRATEACTRHARPLYSAHADLPVPEEPHLAYWHAATLLREHRGDGHLAALLSAGLD
PVEALVSHTATGKGMSPRWVLGSRGWRRADWDGAVERLRGRGLLDAEGALTESGTALRDE
VEEHTDRLDRAPYEHLGAAGVERLTELGRGFLLTAAGAGAFPADLIGRG
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgactgctctgccgccgcgcgcgggacgccgctgccacaacgccatcaacccg
ttccactccacgctgtacttctcgcccgacctggaccgcgagttcggcgccctgggattc
acggaccggagcgcgatgcggctcgccgcacgcagcgccgccctcggcgcggtgggcgcc
ggcaccgtcgccgcgaccttctacaactacaaccacgagctgctcgcccagcacctcccc
gccgtctgggagaccgcctcccccgccgccgtcctcgacgcccggctgcggaccgtcgac
gcgaccctgcgccggctgctcggcgaggagaccgtcgcctccccggagatggcggaggcg
gcggagctcgccctgcgcgccaccgaggcctgcacccggcacgcccggccgctgtactcg
gcccacgcggacctgccggtgcccgaggaaccccacctcgcctactggcacgccgccacc
ctgctgcgcgagcaccggggcgacgggcacctcgcggccctgctctccgccgggctcgac
cccgtcgaggcgctcgtctcccacaccgccaccggcaagggcatgtccccgcgctgggtg
ctcggctcccgcggctggcggcgcgccgactgggacggggcggtggagcggctgcgcggg
cgcggcctcctcgacgccgaaggggcgctgaccgagtccggtacggccctgcgcgacgag
gtcgaggagcacaccgaccggctcgaccgcgccccgtacgagcacctcggcgcggccggc
gtcgagcggctcaccgagctgggccgcggcttcctgctcacggcggccggcgcgggcgcc
ttccccgcggacctcatcggcaggggctga

DBGET integrated database retrieval system