KEGG   Streptomyces venezuelae: SVEN_6430Help
Entry
SVEN_6430         CDS       T02274                                 

Definition
(GenBank) Transcriptional regulator, AraC family
Organism
sve  Streptomyces venezuelae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI HTH_18 HTH_AraC
Motif
Other DBs
NCBI-ProteinID: CCA59716
UniProt: F2RF31
Position
7016214..7017185
Genome map
AA seq 323 aa AA seqDB search
MTQRPVLVVLFDGVQSLDVTGPFEVFAGAGRAAGDPHAYPLRTASLDGGPVRTHSGLRLL
PDTTLAEAVADGAPHTLVVPGGEGTRAPDPALIDWLRTHAPAAARLVSVCTGALLLAEAG
LLDGHRATTHWVACDHLARCYPEVEVDPDPIFVRDGRISTSAGVTAGIDLALALVEEDHG
RDVALTVARHLVVFLRRPGNQAQFSVQLAAQTARREPLRDLQQWITEHPEGDLSVEALAA
RARLSPRHFARAFHAETGTTPGRYVDRVRLEHARRLLEETTHGVEEVSRASGYGTPEAMR
RAFTKVLGTAPADYRRRFHSPAS
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcgacccgttctcgtcgtcctcttcgacggcgtgcagagcctcgacgtcacc
ggtcccttcgaggtgttcgccggtgccggccgggccgccggagacccccacgcgtacccg
ctccgcaccgcctccctggacggcggacccgtccgcacccacagcggcctgcggctgctc
cccgacaccaccctcgccgaggcggtcgccgacggcgccccgcacaccctcgtcgtcccc
ggcggcgaaggcacccgggcccccgacccagccctgatcgactggctccgcacccacgcc
ccggcggccgcgcgcctggtctccgtctgcaccggggcgctgctcctcgccgaggccggg
ctcctcgacggccaccgggcgaccacccactgggtcgcctgcgaccacctggcccgctgc
taccccgaggtcgaggtggaccccgaccccatcttcgtacgggacggacggatctccacc
tccgccggggtcaccgcaggcatcgacctggccctcgccctggtggaggaggaccacggc
cgggacgtggccctcaccgtcgcccgccacctcgtcgtcttcctgcgccgccccggcaac
caggcccagttcagcgtccagctcgccgcccagaccgcccgccgggagccgctgcgcgac
ctccagcagtggatcaccgagcaccccgaaggcgacctctcggtcgaggccctcgccgcc
cgcgcccgcctctcgccccgccacttcgcccgcgccttccacgcggagaccggcacgacc
cccggccggtacgtcgaccgggtacggctcgaacacgcccgccgcctcctggaggagacc
acccacggggtcgaggaggtctcccgcgcctcgggctacggcacccccgaggcgatgcgc
cgcgccttcaccaaggtcctcggcaccgctcccgcggactaccgccgccgcttccactca
cccgccagctga

DBGET integrated database retrieval system