KEGG   Streptomyces venezuelae: SVEN_6435Help
Entry
SVEN_6435         CDS       T02274                                 

Definition
(GenBank) Isopentenyl-diphosphate delta-isomerase
  KO
K01823  isopentenyl-diphosphate Delta-isomerase [EC:5.3.3.2]
Organism
sve  Streptomyces venezuelae
Pathway
sve00900  Terpenoid backbone biosynthesis
sve01100  Metabolic pathways
sve01110  Biosynthesis of secondary metabolites
sve01130  Biosynthesis of antibiotics
Module
sve_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
sve_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:sve00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SVEN_6435
Enzymes [BR:sve01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.2  isopentenyl-diphosphate Delta-isomerase
     SVEN_6435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-ProteinID: CCA59721
UniProt: F2RF36
Position
complement(7019952..7020578)
Genome map
AA seq 208 aa AA seqDB search
MGMPTTPATATQISPEISSNGVQPSGAPAPIMLELVDEDGTTIGTAEKLAAHQAPGLLHR
AFSVFLFDESGRLLLQRRALGKYHSPGVWSNTCCGHPYPGEAPFAAAARRTFEELGVSPT
LLAEAGTVRYNHPDPASGLVEQEFNHLFVGLVQADPRPDPEEIEDTAFVTAAELAERHAA
APFSAWFMTVLDAARPAVRELTGPAGGW
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgggtatgccgaccacaccagccaccgcgactcagatctcgccggagatctcgtcgaac
ggtgtccagccgtccggagccccggcgccgatcatgctcgaactggtcgacgaggacggg
acgaccatcgggacggcggagaagctcgccgcccaccaggcccccggcctgctgcaccgc
gcgttctccgtcttcctgttcgacgagtcgggccggctgctgctgcagcgccgcgcgctc
ggcaagtaccactcccccggcgtctggtcgaacacctgctgcggccacccctacccgggt
gaggcgccgttcgccgcggcggcccgccggaccttcgaggagctcggcgtctcccccacc
ctcctcgcggaggcgggcaccgtccgctacaaccacccggacccggcctccggcctggtg
gagcaggagttcaaccacctcttcgtcggtctcgtgcaggccgacccgcggccggacccg
gaggagatcgaggacacggccttcgtgaccgccgccgagctggccgagcgccacgccgcc
gcgcccttctccgcctggttcatgacggtgctggacgcggcgcgtccggcggtcagggaa
ctgacgggtccggccgggggctggtga

DBGET integrated database retrieval system