KEGG   Streptomyces venezuelae: SVEN_6461Help
Entry
SVEN_6461         CDS       T02274                                 

Definition
(GenBank) Transcriptional regulator, TetR family
Organism
sve  Streptomyces venezuelae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_C_6 TetR_N TetR_C_7 TetR_C_27 TetR_C_31 TetR_C_24 tRNA_edit TetR_C_17
Motif
Other DBs
NCBI-ProteinID: CCA59747
UniProt: F2RG27
Position
complement(7046553..7047284)
Genome map
AA seq 243 aa AA seqDB search
MARVRLSVAERREELLRAAVEQIEARGVAAVRIADVASALGVSNALVLYHFSSKEQLVAA
AFAHAAEADLAHLRRLLGRRSTAVRRLRAAVRWYAPTGQAKGWRLWIEGWAASLRDPELR
RVAASLDQEWKAALTRVIAEGAAAGEFRCADPAAAAWRLTALLDGLAVQTTAYAGSLSRT
AMLRWADEALDRELSLPRANGRTNEHGTGRGAETPRPEGPALEETTDAPDGTEDAPVSPG
AHA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
gtggcgagagtgcggttgagcgtggcggaacggcgggaggagctcctgcgggccgccgtc
gagcagatcgaggcgcgcggggtcgcggccgtccggatcgccgacgtggcgtccgcgctc
ggcgtgagcaacgccctggtgctctaccacttctcgtccaaggagcagctggtcgccgcc
gcgttcgcgcacgccgccgaggccgacctggcgcatctgcggcggctcctcggccgccgc
tccaccgccgtacgccggctgcgtgccgcggtgcgctggtacgcgccgaccgggcaggcc
aagggctggcggctgtggatcgagggctgggcggcctcgctgcgtgaccccgaactgcgc
cgggtcgccgcctccctcgaccaggagtggaaggccgcgctcacccgggtgatcgcggag
ggcgccgccgccggcgagttccgctgcgcggacccggccgcggcggcctggcggctcacc
gccctgctcgacggcctcgcggtccagacgacggcgtacgccggctccctctcccgcacg
gcgatgctccgctgggcggacgaggccctcgacagagagctgagcctcccgagggccaac
ggccggacgaacgagcacggaaccggacgcggtgccgaaaccccccggcccgaagggccc
gccctcgaagagaccacagacgcacccgacgggaccgaggacgcacccgtcagccccggc
gcccacgcctga

DBGET integrated database retrieval system