KEGG   Streptomyces venezuelae: SVEN_6465Help
Entry
SVEN_6465         CDS       T02274                                 

Definition
(GenBank) hypothetical protein
Organism
sve  Streptomyces venezuelae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_trans_NIPA 7TMR-DISM_7TM EamA
Motif
Other DBs
NCBI-ProteinID: CCA59751
UniProt: F2RG31
Position
7052405..7053040
Genome map
AA seq 211 aa AA seqDB search
MAHLFGQAGGAYRVNHGSPPVSSPVPAPPSGEDRWMGVVLPVLFSLCAAFSNALATVLQR
RAALTVRRTDSFRPGLILDLLRRPLWLAGILAVIVAGVGQAAALATGPLSLVQPLFVLEL
PLALLIASLMTRERLPSALWAAVAAVVVGLGVALAAASPSGNRTHVPLDRWIPALAXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXRSPPP
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
gtggcccaccttttcgggcaggccggcggggcgtaccgggtgaaccacgggtcaccgccg
gtgtcgtcaccggtgccggctccgccgtcgggtgaagatcggtggatgggcgtcgtcctg
ccggtcctcttctccctgtgcgccgccttcagcaacgcgctcgccacggtgctgcagcgc
cgcgccgccctcaccgtccgccggaccgactccttccggcccggcctgatcctcgacctg
ctgcgccgcccgctctggctcgccggcatcctcgcggtgatcgtcgccggcgtcgggcag
gccgccgccctggcgaccggcccgctctccctcgtccaaccgctgttcgtcctggaactg
ccgctcgcgctgctcatcgcctcgctgatgacccgggaacggctgccgtcggcgctctgg
gccgccgtcgccgccgtggtggtgggactcggggtggcgctcgccgcggcctcgccgagc
gggaaccgtacgcacgtgccgctggaccgctggatcccggcactcgcnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnncgctcaccgccgccctga

DBGET integrated database retrieval system