KEGG   Streptomyces venezuelae: SVEN_6468Help
Entry
SVEN_6468         CDS       T02274                                 

Definition
(GenBank) Membrane-fusion protein
Organism
sve  Streptomyces venezuelae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_3 Biotin_lipoyl HlyD_D23 Biotin_lipoyl_2 DUF2118
Motif
Other DBs
NCBI-ProteinID: CCA59754
UniProt: F2RG34
Position
complement(7058640..7059446)
Genome map
AA seq 268 aa AA seqDB search
MQFRQKALSKLQSPEELDVPVRFARPQGRLVLAVTVVVIALAGYWALTGTVESKLSAPGV
LTHAEGSYLLQSPVAGQVTEVLVEEGRAVPSGTPVLTVRTDKGDRPVRAVAGGRVTTLFA
RTGAVVTTGADVATVERVTDPKAPLVAMLYLPADSASAIQVGARVDLGVPSAPRDRFGVL
RGRVEAVSRTPQTRERIGAFLGDSGLADRFAGQGNPVAVLVRLDRSPGTASGYAWSSADG
PPHPLDSGTPVTGAVHLAAQRPVDWLLP
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
gtgcagttccgccagaaggcgctttccaagctgcaatctcccgaagaactcgacgtcccg
gtgcgcttcgcgcgcccgcaggggcgcctcgtgctcgccgtgaccgtcgtcgtcatcgcc
ctggcgggctactgggcgctcaccggcaccgtcgagtccaagctgagcgcgcccggcgtc
ctcacccacgccgagggcagctatctgctgcagagcccggtcgccggacaggtcaccgag
gtgctcgtcgaggagggccgggccgtcccctccggtacgccggtgctgaccgtccgtacg
gacaagggcgaccggcccgtgcgcgcggtggccggcggccgggtgaccaccctcttcgcc
aggacgggcgcggtcgtcacgaccggcgcggacgtggcgacggtggaacgcgtgaccgac
ccgaaggccccgttggtggccatgctgtacctccccgccgacagcgcgtcggcgatccag
gtgggggcccgcgtcgacctcggcgtcccctccgccccccgcgaccggttcggcgtcctg
cgcggccgcgtcgaggccgtgagccgcaccccccagacccgggagcggatcggcgccttc
ctcggcgacagcggactcgccgaccggttcgccgggcagggcaatccggtcgcggtgctc
gtacggctcgaccgctcccccggcaccgcctccggctacgcctggtcctccgccgacgga
cccccgcacccgctcgactccggcacacccgtcaccggcgccgtccacctcgccgcgcag
cgccccgtcgactggctgctgccgtga

DBGET integrated database retrieval system