KEGG   Streptomyces venezuelae: SVEN_6479Help
Entry
SVEN_6479         CDS       T02274                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K06148  ATP-binding cassette, subfamily C, bacterial
Organism
sve  Streptomyces venezuelae
Brite
Transporters [BR:sve02000]
 ABC Transporters, Eukaryotic Type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    SVEN_6479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_16 ABC_membrane AAA_29 SMC_N AAA_30 RsgA_GTPase AAA_22 IstB_IS21 NTPase_1
Motif
Other DBs
NCBI-ProteinID: CCA59765
UniProt: F2RG45
Position
complement(7068837..7070708)
Genome map
AA seq 623 aa AA seqDB search
MTPPPRPGRERKPTAPRATDRPAPEVTAPRTAPARGVPPPGPAASSPEAESARRVTAFLR
SLLVRRKGVLAKLAAWSAAESAQTFLGGYCVARSLDDGFLKGTPSTGLLWLAGAAVAILL
GAPVVRGVFAQLPPLTEPLRDELVRGSVVRALRTATTTGGRADTTAVSRLTSQTEIARDS
FAGLVLATRSFVFVAVGALAGLLSLAPQFLLVVLPPLVLGLALFTVSLRPMARAQHRYLD
ADEAVGRRAEITRSALRDTVACGAQEATAAQNRRAVDEAAAAQRALARWASVRTFAVATA
GQLPVLLLLVATPWLLRQGVTAGAVVGALTYVLQSLLPALHTLMTVLGAAGARLFVVLDR
LTRPLPPGPSPADAPPGPRRTGRAATALELRHVRASYGPWARPVLDALELTVEQGEHIAV
VGPSGIGKSTLLHVAAGMLTPDQGEVRLFGHAVAACSRPELTALRVLTPQEAYVFTGTLR
DNLRYLRPGADPSAVDRTVDALALESLVDRVGGLDRTLTPDALSLGERQLIALGRAHLAP
APLLLLDEATCHLDPVAEATAERALSARPGTLVVVAHRLSSALRADRILVLDGTRAQYGT
HEELLARSALYRDLVGHWSQVRG
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
gtgacgccccctccgcgcccggggcgggagaggaaaccgacagcgccgagggcgacggac
cgtccggcgccggaggtcaccgccccgaggacggccccggcccggggtgtcccccctccg
ggaccggcggcctcctcccccgaggcggagtcggcccggcgcgtcaccgccttcctccgg
tcactcctcgtgcgccgcaagggcgtcctggcgaaactggcggcgtggtcggccgccgaa
tccgcgcagacgttcctcggcggctactgcgtggcccgctccctcgacgacggatttctg
aaaggcacgccctcgaccggcctcctctggctggcgggggccgccgtggccatcctcctc
ggcgctcccgtcgtccggggcgtcttcgcccagctgccccccctcacggaaccgctgcgc
gacgaactcgtacgcgggtcggtggtacgcgccctgcgcaccgccacgaccacgggcggg
cgcgcggacacgaccgcggtgtcccggctgacgagtcagaccgagatcgcccgagacagc
ttcgccggactggtgctggccacccgctccttcgtcttcgtggccgtcggggccctcgcc
ggactgctgtcgctcgcgccgcagttcctcctcgtcgtgcttccgcccctggtccttggc
ctcgccctgttcacggtctccctgcggcccatggcgcgggcccagcaccggtacctcgac
gcggacgaggccgtcgggcggcgtgccgagatcacccgctccgccctgcgggacacggtg
gcctgcggtgcccaggaggcgaccgccgcgcagaaccgccgtgccgtcgacgaggcggcc
gccgcccaacgcgccctggcccgctgggcgtccgtccgtacgttcgcggtggcgacggcc
ggacagctgccggtcctcctgctgctcgtcgccacaccgtggctgctccgccagggcgtc
acggccggtgccgtggtgggtgccctcacctacgtcctccagtcgctgctccccgccctg
cacaccctgatgaccgtcctgggcgccgcgggcgcgcggctcttcgtcgtcctcgaccgg
ctcacccgaccgctgcccccgggcccttcccccgccgacgccccgcccggcccgcgccgt
acgggccgggcggccacggcgctggagctgcgccacgtacgcgcgtcgtacggcccctgg
gcacgccccgtcctcgacgcgctggaactcaccgtcgagcaaggggaacacatcgctgtg
gtcggcccgagcggcatcggcaagtcgaccctgctgcacgtcgcggcgggcatgctcacc
cccgatcagggcgaggtacggctcttcggccacgccgtcgccgcctgctcgcgcccggag
ctcaccgccctgcgcgtgctgactccccaggaggcgtacgtcttcacgggcaccctgcgg
gacaacctgcggtacctgcggcccggcgccgatccgtccgccgtcgaccggaccgtggac
gcgctcgccctggaatccctcgtcgaccgggtgggcgggctcgaccgtacgctgacgccc
gacgccctgtccctcggcgaacgccagctgatcgcgctgggacgcgcccatctggccccc
gcccccctgctgctgctcgacgaggcgacctgccacctggaccccgtcgccgaggccacg
gccgagcgggcgctgagtgcgcggccaggaaccctggtcgtggtcgcccaccggttgtcc
tcggcactccgggccgacaggatcctcgtcctcgacggcacccgggcccagtacggaacg
cacgaggaactgctcgcgcgttccgctctctaccgcgatctggtggggcactggagccag
gtccgagggtga

DBGET integrated database retrieval system