KEGG   Streptomyces venezuelae: SVEN_6485Help
Entry
SVEN_6485         CDS       T02274                                 

Definition
(GenBank) oxidoreductase
  KO
K06988  8-hydroxy-5-deazaflavin:NADPH oxidoreductase [EC:1.5.1.40]
Organism
sve  Streptomyces venezuelae
Brite
KEGG Orthology (KO) [BR:sve00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SVEN_6485
Enzymes [BR:sve01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.40  8-hydroxy-5-deazaflavin:NADPH oxidoreductase
     SVEN_6485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F420_oxidored 3HCDH_N NAD_binding_2 ApbA Rossmann-like TrkA_N Pyr_redox NAD_Gly3P_dh_N Sacchrp_dh_NADP UDPG_MGDP_dh_N XdhC_C THF_DHG_CYH_C DAO Pyr_redox_2 2-Hacid_dh_C Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: CCA59771
UniProt: F2RG51
Position
complement(7078407..7079009)
Genome map
AA seq 200 aa AA seqDB search
MSTYEIAVLGNGRVGGSLATALTRAGHRVTTADRTPGAAASAARTARIVINATPGAGSPQ
RLGALREELRGKILVDVSNATTDGPDGLPAGLLHPGSSLAELLQEALPETHVVKTLNTML
YPVMTAPATLTHPPTAFLSGENPQAKQTVREILTDLGWKNEWITDLGGIRTARATEAAIL
FVPHVIRSRGFEPFAISLSR
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtccacgtacgagatcgcagttctgggaaacggccgcgtcggcggcagcctggccacc
gccctgacccgagccgggcaccgggtcaccacggcggaccgcacgccgggcgccgccgcc
tcggccgcccgcaccgcccggatcgtcatcaacgccacgcccggcgccggctctccgcaa
cgcctcggcgcgctgcgggaggaactgcggggcaagatcctcgtcgatgtctccaacgcc
accaccgacggccccgacgggctccccgccggcctgctccaccccggctccagcctcgcc
gaactgctccaggaagcgctccccgaaacgcacgtcgtcaagacgctcaacaccatgctc
taccccgtgatgaccgcgccggccaccctcacccacccgcccaccgcgttcctctccgga
gagaacccccaggccaagcagaccgtccgcgagatcctcaccgacctcggctggaagaac
gagtggatcaccgacctgggcggaatccggaccgcccgcgccacggaggccgcgatcctc
ttcgtcccccacgtgatccgctcccgcggattcgagcccttcgcgatctccctcagccgg
tga

DBGET integrated database retrieval system