KEGG   Streptomyces venezuelae: SVEN_6486Help
Entry
SVEN_6486         CDS       T02274                                 

Definition
(GenBank) Inositol-1-monophosphatase
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
sve  Streptomyces venezuelae
Pathway
sve00521  Streptomycin biosynthesis
sve00562  Inositol phosphate metabolism
sve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    SVEN_6486
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SVEN_6486
Enzymes [BR:sve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     SVEN_6486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-ProteinID: CCA59772
UniProt: F2RG52
Position
complement(7079054..7079875)
Genome map
AA seq 273 aa AA seqDB search
MSAPHQASSGGPLSDADLLARTVTAVRTAGSALRERFGEVVRHETREELMRALAANDDTV
LSTLRPRLRALRPHAGWVEDELDGGALPSGEWWVVDPAEGNVNHLHALPDWAVTATLVRE
NRPVLTVVHVPLTGETYTALAGGGAHLDGRPLHVSRTAELGLSIVATSQARPDEDEEVVR
RTGASITAMLLDALVVRTAVPATLHLANVAAGRLDVFWQYAGARADLLPGALLVQEAGGR
VTDAGGRPWTTRSTSFLAAAPGVHAHAAAALAR
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcaccccatcaggcctcttccggtggccccctctccgacgccgacctgctggcc
cggaccgtgaccgccgtacgcacggccggctcggcactgcgcgagcgcttcggcgaggtg
gtccgccacgagacccgcgaggagctgatgcgcgccctcgccgccaacgacgacacggtc
ctctccaccctgcgcccccgtctcagggccctgcgcccgcacgccggctgggtggaggac
gaactcgacggcggagcactgccgtccggcgaatggtgggtcgtggacccggccgaaggc
aatgtcaaccatctgcacgcccttcccgactgggcggtgaccgccaccctggtacgcgag
aaccggcccgtgctgacggtcgtccacgtgccgttgacgggcgagacctacaccgctctc
gccggaggaggcgcccacctcgacggccggccgctgcacgtctcccggacggcggagctc
gggctgagcatcgtcgccaccagccaggcccggccggacgaggacgaggaggtcgtacgc
cgcacaggcgcttcgatcaccgccatgctcctcgacgccctcgtcgtacggaccgccgtg
cccgcgaccctgcacctggcgaacgtcgccgccggccggctcgacgtcttctggcagtac
gccggagcccgcgcggacctgctgcccggcgccctgctcgtccaggaggccggcggccgg
gtcaccgatgccgggggccgcccctggaccacgcggagcaccagcttcctggccgccgca
cccggcgtacacgcccacgccgccgcggcgctcgcccgctga

DBGET integrated database retrieval system