KEGG   Streptomyces venezuelae: SVEN_6489Help
Entry
SVEN_6489         CDS       T02274                                 

Definition
(GenBank) putative TetR-family transcriptional regulator
Organism
sve  Streptomyces venezuelae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N TetR_C
Motif
Other DBs
NCBI-ProteinID: CCA59775
UniProt: F2RG55
Position
complement(7081848..7082537)
Genome map
AA seq 229 aa AA seqDB search
MARQGTGRRRASHSMESVLGEAVALLDEAGAPALTFRALAQRLGGGVASIYWYVANKDEL
LDLATDHVMAGVLADLDTLPPTQDPIDDLRAMALTLFDAVVRRPWLGAYFMRNTDVQSNS
LRIYEMLGRQTLRLNLTARQRFHAVSAVIGVVVGSAIDMGQEPPQEVLDGAVNRDEFLGR
FAQAWRELAPQDFPFIHEIVDEFDGHDDTDQFRSALDLTLAGLRLQAGL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggcccgccaggggacggggcgccgacgcgcctcgcactcgatggaatccgtcctcggc
gaagcggtcgccctgctcgacgaggcaggagcccccgccctgaccttccgcgccctggcc
cagcgcctgggcggaggcgtcgccagcatctactggtacgtcgcgaacaaggacgaactc
ctcgacctcgccacggaccacgtcatggccggcgtgctcgccgacctcgacacgctcccg
cccacccaggaccccatcgacgacctgcgcgccatggccctcacgctcttcgacgccgtc
gtccgccgcccctggctcggcgcctacttcatgcgcaacaccgacgtgcagagcaactcc
ctgcgcatctacgaaatgctcggccgccagaccctgcgcctgaacctcaccgcccgccag
cgcttccacgccgtctcggccgtcatcggcgtcgtcgtcggctcggccatcgacatgggc
caggaaccaccccaggaagtcctggacggcgcggtgaaccgggacgagttcctcggccgt
ttcgctcaggcatggcgggaactcgccccccaggacttccccttcatccacgagatcgtc
gacgagttcgacggccacgacgacacggaccagttccgctccgccctcgacctcaccctg
gcgggcctccgcctccaggcgggcctctga

DBGET integrated database retrieval system