KEGG   Streptomyces venezuelae: SVEN_6490Help
Entry
SVEN_6490         CDS       T02274                                 

Definition
(GenBank) hypothetical protein
Organism
sve  Streptomyces venezuelae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_2
Motif
Other DBs
NCBI-ProteinID: CCA59776
UniProt: F2RG56
Position
7082655..7084124
Genome map
AA seq 489 aa AA seqDB search
MTTATLTNPPRTYPSLRAAWIPLAALCLAFFVEMVDNTLLSIALPTIGRDLGGGTTALQW
VTGAYSLTFGGLLLTAGSIADRFGRRRVLLIGLGIFGTLSLGVLLVHSAGGLIALRAGLG
IAAAAMAPITNSLVFRLFDDKALRMRAMTVMIVVGMSGFVLGPLLGGTALAHVSWEWLLL
VNAPIAVIACVGVRLGVPADRPQDLTKDSLDVPGAVLSVAAIGLACYSLTSGVEHGWLST
ITLASVVGALAAALLFVRHERRTATPMLDLRLFSRGTVRGAALAQIGTSIAMASVMFGLI
LHFQYAYGWSPVRAGLANLPIIATMLLATPLSEWLARSFGHRVACLVGAGFLAGSLAGLA
WGVEHGYAVIAVCMVLMTIGLRTVMTICAVALVDAMPANRTSIGAALNDTAQEVGSSVGT
AVVGTLIAVLVTTQLPAGTWSGELIASFFHGERITYALLAVVVGLIAAGGALSLTDSRSV
EEHPVEETA
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgccaccctcaccaacccgccccgcacctacccgtcgctgcgcgcggcgtgg
atccccctggccgcgctctgcctggccttcttcgtcgagatggtcgacaacaccctgttg
tcgatcgcgctgcccaccatcggccgcgacctgggcggaggcacgaccgcgctccagtgg
gtgacgggcgcctactcgctcaccttcggcggactgctgctcaccgccggatccatcgcg
gaccggttcgggcgccgccgcgtgctcctgatcgggctcgggatcttcggcacgctcagc
ctcggcgtgctcctcgtccattccgcaggcggtctcatcgccttgcgcgcggggctcggc
atagccgcggcggcgatggcgccgatcacgaactccctggtcttccggctcttcgacgac
aaggcgctccggatgcgcgccatgaccgtgatgatcgtcgtcggcatgtccggattcgtc
ctcggcccgctgctcggcggtacggcgctggcgcacgtgtcctgggagtggctgctcctc
gtcaacgcccccatcgcggtcatcgcctgcgtcggagtgcggctcggcgtgccggccgac
cgcccgcaggacctcaccaaggactccctcgacgtgccgggcgccgtcctgagcgtcgct
gccatcggtctcgcctgctactccctgaccagcggcgtcgagcacggctggctctccacg
atcaccctcgcgtccgtcgtcggcgccctcgccgcggctctcctgttcgtccggcacgag
cgccgcacggccacgcccatgctcgatctgcggctcttctcgcgcggcaccgtccggggc
gccgccctcgcgcagatcggcacgtcgatcgccatggccagcgtcatgttcggcctgatc
ctgcacttccagtacgcctacggctggagccccgtgcgggccggcctcgccaacctgccg
atcatcgcgaccatgctgctggccaccccgctgtccgagtggctcgcccggagcttcggg
catcgcgtcgcctgtctggtgggcgccgggttcctcgccggctcactcgccgggctcgcc
tggggcgtcgagcacggctacgccgtcatcgccgtctgcatggtcctcatgaccatcgga
ctgcgcaccgtcatgacgatctgcgcggtcgccctcgtcgacgccatgccggccaaccgc
acctccatcggcgccgcgctcaacgacaccgcccaggaagtcggctccagcgtcggcacc
gccgtcgtcggcaccctcatcgccgtgctggtcaccacccagctcccggccggcacctgg
agcggcgaactcatcgcgtccttcttccacggcgagcgcatcacctacgccctgctcgcc
gtcgtcgtcggcctgatcgccgccggcggcgcactgagcctcaccgattcccgctccgtg
gaggaacacccggtcgaggagacggcctga

DBGET integrated database retrieval system