KEGG   Streptomyces venezuelae: SVEN_6491Help
Entry
SVEN_6491         CDS       T02274                                 

Definition
(GenBank) Phytochrome, two-component sensor histidine kinase
Organism
sve  Streptomyces venezuelae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHY HATPase_c GAF PAS_2 HisKA PAS_4 NUT
Motif
Other DBs
NCBI-ProteinID: CCA59777
UniProt: F2RG57
Position
7084260..7086623
Genome map
AA seq 787 aa AA seqDB search
MAEEWLSRRARDAESAVPGGFDLSDCVREPIHLLGGVQSHGTLLAVEADGGVVDTAAANT
LAVLGFPAEDLVGAHVTAVLSEEDWTDACRSVAEEGETSALQVEAGPVGAPRRFDLSLHR
SGPLVVLEFEPREEGLEFRFTGFYQGVRRALARLRSTVDVVDGCRAAVREIRALTGYDRV
VAYRFDGPEGPGEVLAEDVTDAWEPWLGLWFPATDIPPQARRLYEENWIRVIGDVDDSTV
GLVPPVRAGTGTPLDLSGAALRTVSGFHLEYLRNIGVRSSMSVSVMREGRLWGLIACHGA
APFHPAPEVRAACELFGAAFSLQLAAIEERERADALAGAAGRAASVAELLDADVEMSLPP
HGGAVRDLVGADSAVLVRGARSVATGAPVPAALVTELRRRAGGMTPGTVWATDRLGELMA
DEDIHVPELDGGQAGVLLVRLTSPGDFLAWFRAERPTPRMWATDPATPVRVGPRGERLTP
RGSSEVFRSVMRGRSLPWRPREQAAAAELGRMLTRLVLRHAEELAALNEELRMSNLDLDS
FAHAAAHDLKEPLRGISNAATFTMEDAGAALDPTSVRRLLTIRRLAGRMDELLNSLLHYA
RLGQAGLRRVTVDLDEAVDAALEVAGPRLAEERVRVVRDTPLPHVEADPTRLYEILVNLL
VNAAKYAAERPDRMVSIGVEEVPAECGGGADAGTAGTRPGRTERAVVVRDNGIGIPPELQ
ADVFDLFRRLHGPAEHGGGTGVGLAVVKRIVERHGGRLWLESEPGSGTAFYFTLGEPPVP
SGAGESG
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaggaatggctgtcgcggagggcgcgcgatgccgagtcggcggtgcccgggggg
ttcgacctctccgactgcgtgcgcgagcccattcacctcctggggggcgtgcagtcccac
gggacgctcctcgcggtggaggcggacgggggtgtcgtcgacaccgccgccgccaacacc
ctcgccgtactcggattccccgccgaggacctcgtcggcgcgcacgtcaccgcagtcctg
tcggaggaggactggacggacgcgtgccggagcgtcgccgaggagggcgagacctccgcg
ctccaggtggaagccgggcccgtcggagccccgcgccggttcgacctgtccctgcaccgg
tcgggaccactcgtcgtgctggagttcgagccgcgtgaggagggcctggagttccgcttc
acgggcttctaccagggagtccggcgcgccctggcccggctgcggtcgacggtcgacgtc
gtcgacggctgccgggccgccgtgcgcgagatccgggctctgaccgggtacgaccgggtc
gtcgcctaccgcttcgacggtcccgaggggccgggcgaggtcctcgccgaggacgtgacc
gacgcgtgggagccctggttgggcctctggttcccggcgaccgacatcccgccgcaggcc
aggcgcctgtacgaggagaactggatccgggtcatcggggacgtcgacgactccaccgtc
ggcctggtgcctcccgtgcgggccggcacgggaacaccgctcgacctgtcgggagccgcg
ttgcggacggtctccgggttccacctcgagtacctgcgcaacatcggcgtccgctcgtcg
atgtccgtctccgtgatgcgggagggccggctgtggggcctcatcgcctgccacggtgcc
gcgcccttccatcccgcgcccgaggtgcgggccgcctgcgagctcttcggggcggcgttc
tcactgcaactcgccgccatcgaggagcgggagcgtgccgacgcgctggccggggcggcc
gggcgggcggcgtccgtggcggaactcctcgatgccgacgtggagatgtcgctgcctccg
cacggtggcgccgtgcgggacctggtcggcgcggactcggccgtcctcgtacgcggtgcc
cgctcggtcgccaccggcgcccccgttcccgccgcactcgtgacggagttgcgccggcgc
gccggcgggatgactcccgggaccgtgtgggccaccgaccggctgggtgagctcatggcg
gacgaggacatccacgtgccggagctcgacggcggccaggcgggcgtgctcctggtcagg
ctcacgtcgccgggcgacttcctggcctggttccgcgccgagcgcccgacaccccggatg
tgggcgaccgaccccgcgacgcccgtgcgcgtcggaccgcgtggcgagcgactgacgccc
cgcggttccagcgaggtgttccgctcggtcatgaggggccgctcgctgccctggaggcca
cgcgagcaggccgccgccgctgaactcggacggatgctgacccggctggtcctgcggcac
gcggaggagctcgccgccctcaacgaggaactccgcatgagcaacctggacctcgactcc
ttcgcccacgccgccgcccacgacctgaaggagcccctccgcggcatctccaacgccgcc
accttcaccatggaggacgcgggagcggcgctcgacccgaccagtgtgcgcaggctcctc
accatccggaggctggccggccggatggacgaactcctcaactcgctcctgcactacgcc
cgcctcgggcaggcggggctgcgacgcgtcaccgtcgacctggacgaagcggtggacgcc
gcactggaggtggcggggccgaggctcgcggaggagcgtgtccgtgtcgtccgcgacacc
ccgctcccacacgtcgaagccgaccccacgcggttgtacgagatcctggtcaatctgctg
gtcaacgcggcgaagtacgcggccgaacgccccgaccgcatggtgtcgatcggcgtggag
gaggtgccggccgagtgcggtgggggagcggacgccgggacggcggggacgcgtccgggc
aggacggagcgggccgtggtggtgcgtgacaacggcatcggcatcccgcccgagctgcag
gcggacgtgttcgacctgttccgccgcctccacggcccggccgagcacggtggcggcacg
ggcgtgggactggccgtcgtcaagcggatcgtggagcgacacggcggccggctgtggctg
gagagcgagccgggcagcggcacggccttctacttcaccctgggggagccgcccgtcccg
tccggtgccggggaatccggctga

DBGET integrated database retrieval system