KEGG   Streptomyces venezuelae: SVEN_6497Help
Entry
SVEN_6497         CDS       T02274                                 

Definition
(GenBank) Methyltransferase type 11
Organism
sve  Streptomyces venezuelae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 Methyltransf_12 Ubie_methyltran Methyltransf_23 MTS Methyltransf_8 Methyltransf_9
Motif
Other DBs
NCBI-ProteinID: CCA59783
UniProt: F2RG63
Position
7093105..7093890
Genome map
AA seq 261 aa AA seqDB search
MWVTGEAYEPYVGRWSSQVAHRFVRWMGAAPRESWRDVGCGTGAVTRAVLDLADPATVVG
LDPSAGFVAYARRTIADHRARFVLADAESLPFADSSASVAVSGLVLNFVPDPDRAAAEMA
RVVRPGGLVGAYVWDLGDGGMEIIRAFWDAASALDPEARALDEAVRFPLCARAPLGELFV
RAGLEDVEVDGITVPARFADFDDYWQPFLGAQGPAPAYVATLPEERRGALRERLRSALPR
AEDGSIPLRARAWAVRGRRPG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtgggtgacgggtgaggcgtacgagccgtacgtgggacggtggagcagtcaggtggcc
caccggttcgttcgctggatgggcgcggctccccgggaaagctggcgcgatgtcggatgc
ggcacgggtgcggtgacgcgggccgtgctggatctggccgatcccgcgacggtcgtcggc
ctcgacccctccgccggcttcgtggcgtacgcgcggcggaccatcgccgaccaccgggcg
cggttcgtcctggccgatgccgagagcctgccgttcgccgactccagcgcttcggtcgcc
gtgagcgggctcgtgctcaacttcgtacccgaccccgaccgcgcggccgcggagatggcc
cgggtggtcaggcccggcgggctcgtgggggcgtacgtctgggacctgggcgacggaggc
atggagatcatccgcgccttctgggacgccgcgtccgcgctcgatccggaggcccgggcc
ctggacgaggccgtcaggtttccgctctgtgcccgcgcgccgctgggcgagctgttcgtg
cgggcggggctcgaggacgtcgaggtcgacgggatcaccgtgcccgcgcgtttcgcggat
ttcgacgactactggcagccgttcctcggagcgcagggaccggcgcccgcctacgtggcc
acgcttccggaggagcggcgcggggcactgcgcgagcggttgcggtcggcgttgccccgt
gcggaggacggttcgatcccgctgcgcgcgcgggcatgggccgtgcggggcaggcgcccg
ggctga

DBGET integrated database retrieval system