KEGG   Streptomyces venezuelae: SVEN_7362Help
Entry
SVEN_7362         CDS       T02274                                 

Definition
(GenBank) Beta-hexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
sve  Streptomyces venezuelae
Pathway
sve00511  Other glycan degradation
sve00520  Amino sugar and nucleotide sugar metabolism
sve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sve00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SVEN_7362
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SVEN_7362
Enzymes [BR:sve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SVEN_7362
Chaperones and folding catalysts [BR:sve03110]
 Intramolecular chaperones
  Others
   SVEN_7362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b E3_binding
Motif
Other DBs
NCBI-ProteinID: CCA60648
UniProt: F2R1Y1
Position
complement(8103984..8105522)
Genome map
AA seq 512 aa AA seqDB search
MPPARSAPAPGRPRLVPEPTQLQSLPGRFTFDATTALKVSPGAEGAAALLRTLLGPATGL
PLPARADGSVVLALDRALGGLGEEGYGLTIGTEGVLLRAARPRGLLAGVQTLRQLLPVEA
LRAEPVPGVAWSVPCAQITDIPRFPWRGSMLDVARRFRPVSYLRRYVDLLALHKLNVLHL
HLTDDQGWRMPVPALPRLTEVGGLPHGGAYTRAELGGLVAYAAERGVTVVPEIEMPGHVR
AALAAYPELGNHPGRTYEVWDRWGVCDTILGVHDQALDFCRTVLDEVMDVFPSPYVHVGG
EECPTDEWHVSPAARRRAAEEGLPGPAALHGWFMERIGEHLLAAGRHPLSWTEDGADLPP
YFTVMPWRDAEHGRTAVRRGHRVIMAPHRTTYLDYPQSAGPEEPPGQAGEVVDLRTVHGN
DPAPAHWSPEEAGRVLGSQVQLWTEYVPTPAHAEYLTFPRLCALAEVVWTGRHDWPGFQE
RLRHHRTRLDALGVPRRPDAAPASAPVPAPAP
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgccacccgcccgatccgcccccgcccccggccgcccccggctcgtccccgagcccacc
caactccagtcgctgccaggacggttcaccttcgacgccacgaccgcgctcaaggtctcc
cccggcgcggaaggcgccgcggcactgctgcgcacgctcctcgggcccgccaccggcctg
ccgctgcccgcccgcgcggacggctccgtcgtcctggccctcgaccgcgccctcggcggg
ctcggcgaggaggggtacgggctcaccatcggcacggagggggtgctgctgcgggccgcc
cggccccgggggctgctcgccggggtccagaccctccgtcagctgctgcccgtcgaggcg
ctgcgcgccgaaccggtgcccggggtcgcctggtccgtcccctgtgcgcagatcaccgac
atcccccgcttcccctggcgcggctccatgctcgacgtcgcccgccgcttccgtcccgtc
tcctatctgcggcggtacgtggacctcctcgccctccacaaactgaacgtcctgcacctc
cacctcaccgacgaccagggctggcgcatgccggtgccggcgctcccccggctcaccgag
gtgggcgggctgccgcacggcggtgcctacacccgtgcggaactcggcggtctggtggcg
tacgcggcggagcgcggtgtcaccgtcgtgcccgagatcgagatgccgggccatgtacgg
gccgccctcgccgcctatccggagctgggcaaccacccgggccgtacatatgaggtctgg
gaccggtggggtgtctgcgacaccatcctcggcgtccacgaccaggcgctcgacttctgc
cgcaccgttctggacgaggtgatggacgtctttccctccccgtacgtccacgtcggcggc
gaggagtgccccaccgacgagtggcacgtctccccggcggcgcgccggcgggccgccgag
gaggggctgccggggcccgcggccctccacggctggttcatggagcggatcggagagcac
ctcctggccgccggtcgccacccgctcagctggaccgaggacggcgccgacctcccgccg
tacttcaccgtcatgccctggcgcgacgccgagcacggccgcaccgcggtccgccgcggc
caccgcgtgatcatggccccgcatcgcaccacgtacctcgactacccgcagtccgcgggc
cccgaggagccgcccggtcaggcgggcgaggtcgtcgacctgcgcaccgtccacggcaac
gacccggctccggcgcactggagcccggaggaggcgggccgggtcctcgggtcccaggtg
cagttgtggaccgagtatgtgcccaccccggcgcacgccgagtacctcacgttcccccgg
ctctgcgccctcgcggaggtcgtctggaccggccggcacgactggccgggcttccaggag
cggctccgccaccacaggacccggctggacgcgctgggcgtgccgcgccggccggacgcc
gcacccgcgtccgcgcccgtgccggcccccgcaccctga

DBGET integrated database retrieval system