KEGG   Saccharomonospora viridis: Svir_04920Help
Entry
Svir_04920        CDS       T00980                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
svi  Saccharomonospora viridis
Pathway
svi00020  Citrate cycle (TCA cycle)
svi00640  Propanoate metabolism
svi00660  C5-Branched dibasic acid metabolism
svi01100  Metabolic pathways
svi01110  Biosynthesis of secondary metabolites
svi01120  Microbial metabolism in diverse environments
svi01130  Biosynthesis of antibiotics
svi01200  Carbon metabolism
Module
svi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
svi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Svir_04920
   00640 Propanoate metabolism
    Svir_04920
   00660 C5-Branched dibasic acid metabolism
    Svir_04920
Enzymes [BR:svi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Svir_04920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2 ATPgrasp_Ter ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ACU95567
UniProt: C7MU39
Position
488239..489408
Genome map
AA seq 389 aa AA seqDB search
MDLYEYQAKELFAAHGVPVLPGTVVSEAEEARRAAEEIGGQVVVKAQVKTGGRGKAGGVK
LAADPDEAAEKARAILGLDIKGHVTRRVLVTEASEIAEEYYFSFLLDRANRTFLAMASAE
GGMEIEQLAAERPEALAKVPIDPLTGVDLDKAREIVTKANFPEVVREKAAEVIVKLWETF
VSEDATLVEVNPLVRDPKDEIIALDGKVTLDDNAAFRQPKHADLVDVEAEDPLEAKAKAK
GLNYVKLDGQVGIIGNGAGLVMSTLDVVAYAGEKHGGVRPANFLDIGGGASAEVMAAGLE
VILGDPDVKSVFVNVFGGITACDAVANGIVEALKILGDNATKPLVVRLDGNNVEEGRRIL
TEAAHPLVTLVDTMDSAADKAAELAAAGA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtggacctctacgagtatcaggcgaaggagcttttcgctgcccacggcgtacccgtactc
ccggggaccgtggtcagcgaggccgaggaagcccgccgggcggctgaggagatcggcggc
caggtggtggtcaaagctcaggtgaagacaggcggccgaggtaaggccggtggcgtgaag
ctcgccgccgacccggacgaggcggcggagaaggcccgagcgatcctcggactggacatc
aagggacatgtgacgcgccgggtgttggtgaccgaggcgtccgagatcgccgaggagtac
tacttctcgttcctgctcgatcgggccaaccgcaccttcttggccatggcctccgccgag
ggcggcatggagatcgagcagctcgccgccgagcgccccgaggcgctggcgaaggtcccg
attgacccgctgaccggggtcgacctcgacaaggcgcgcgagatcgtcaccaaggccaac
ttccccgaggtcgtgcgggagaaggccgccgaggtgatcgtcaagctgtgggagacgttc
gtctccgaggacgccaccctggtcgaggtgaacccgctggtgcgggacccgaaggacgag
atcatcgccctcgacggcaaggtgacgctcgacgacaacgcggcgttccggcagccgaag
cacgccgacctcgtcgatgtcgaggccgaggacccgttggaggccaaggccaaggccaag
ggcctcaactacgtcaagctcgacggtcaggtcggcatcatcggtaacggtgccggtctg
gtcatgtccacgctggacgtcgtggcctatgcgggcgagaagcacggcggggtgcgcccg
gcgaacttcctcgacatcggcggtggcgcgtcggccgaggtcatggcggccggactcgag
gtcatcctcggggacccggacgtcaagagcgtgttcgtcaacgtcttcggcggtatcacc
gcgtgcgacgcggtggccaacggcatcgtcgaagcgctgaagatcctcggggacaacgcc
accaagccgctggtcgtgcggcttgacggcaacaacgtcgaggagggccgccggatcctg
accgaggcggcgcatccgctggtgacgttggtggacacgatggacagcgcggccgacaaa
gccgccgagttggctgcggcaggtgcgtga

DBGET integrated database retrieval system