KEGG   Saccharomonospora viridis: Svir_06290Help
Entry
Svir_06290        CDS       T00980                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
svi  Saccharomonospora viridis
Pathway
svi00300  Lysine biosynthesis
svi01100  Metabolic pathways
svi01120  Microbial metabolism in diverse environments
svi01230  Biosynthesis of amino acids
Module
svi_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Svir_06290
Enzymes [BR:svi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Svir_06290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ACU95700
UniProt: C7MVI1
Position
645378..646454
Genome map
AA seq 358 aa AA seqDB search
MPSLDLRSDPVDLTAALVDIESVSGAEAGIADAVEAALRAQAPHLEVVRNGDAVLARTNL
GRPSRIVFAGHLDTVPVNDNLPSRRTGSGDDEVLHGLGSVDMKGGDAVFLHLAATLPEPR
HDVTFVFYDCEEVEAERNGLGRIERELPEWLRGDLAVVGEPSNAVIEAGCQGTMRVELRV
EGVRAHTARAWMGSNAIHALAEPLRRLAEYEARVVEIDGLTYREGLQAVRIEGGVAGNVV
PDSAVLTVNHRFAPDVSPEQAEARLRKVFDGYELTVVDCSPGALPGLSAPAAAELVAAAG
GRVAAKLGWTDVARFAALGMPAVNFGPGDPTLAHTKQEQVRVVEIRRVAEVLRSLLSG
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgccctcgcttgacctgcgttccgatcccgtcgatctcaccgccgcgctcgtggacatc
gagagtgtgtccggggccgaggccggcatcgccgatgccgtggaggccgcactgcgtgct
caggcaccgcacctggaggtggtgcgcaacggggacgccgtgctggccaggaccaacctg
ggtaggccgtcccgcatcgtgttcgccggtcatctcgacaccgtgcccgtcaacgacaac
ctgccgtccaggcgcaccggttccggtgacgacgaggtgctgcacggcctcggcagtgtc
gacatgaagggtggtgacgccgtgttcctgcacctcgcggcgaccctgccggagccgagg
cacgacgtcacgttcgtgttctacgactgtgaggaggtcgaggccgagcgcaacggcctg
ggccgcatcgaacgtgaactgcccgagtggttgcgcggcgacctcgccgtcgtgggcgaa
ccgtcgaacgcggtgatcgaggcgggctgccagggcaccatgagggtcgaattgcgtgtg
gaaggtgtccgggcccacaccgcgcgggcgtggatgggttcgaacgccatccacgcgctg
gccgaaccgttgcgtcggctcgcggagtacgaggccagggtcgtggagatcgacggcctc
acctaccgggaggggctacaggcggtacggatcgaaggtggggtggcgggcaacgtcgta
cccgactccgccgtcctgaccgtgaaccaccgtttcgcgcccgacgtgtcgcccgagcag
gccgaggcccgtctgcgcaaggtgttcgacggctacgagctcaccgtcgtcgactgttca
cccggagcgttgccgggcctgtccgcgccggcggccgcggaactcgtcgccgccgcggga
ggacgggtcgcggccaaactcggatggaccgacgtggcccggttcgccgcgctcggcatg
cccgccgtcaacttcgggcctggcgatccgactctggcccacaccaaacaggagcaggtc
cgagtggtggaaattcgccgcgtcgcggaggtgcttcgttcactgttgtccgggtga

DBGET integrated database retrieval system