KEGG   Saccharomonospora viridis: Svir_15890Help
Entry
Svir_15890        CDS       T00980                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
svi  Saccharomonospora viridis
Pathway
svi00010  Glycolysis / Gluconeogenesis
svi00051  Fructose and mannose metabolism
svi00562  Inositol phosphate metabolism
svi01100  Metabolic pathways
svi01110  Biosynthesis of secondary metabolites
svi01120  Microbial metabolism in diverse environments
svi01130  Biosynthesis of antibiotics
svi01200  Carbon metabolism
svi01230  Biosynthesis of amino acids
Module
svi_M00002  Glycolysis, core module involving three-carbon compounds
svi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Svir_15890
   00051 Fructose and mannose metabolism
    Svir_15890
   00562 Inositol phosphate metabolism
    Svir_15890
Enzymes [BR:svi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Svir_15890
Exosome [BR:svi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Svir_15890
  Exosomal proteins of bladder cancer cells
   Svir_15890
  Exosomal proteins of melanoma cells
   Svir_15890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACU96624
UniProt: C7MSM6
Position
1631171..1631956
Genome map
AA seq 261 aa AA seqDB search
MARKPLIAGNWKMNLNHLEAIALVQKIAFSLPEKYYEKVDVTVLPPFTDIRSVQTLVDGD
KLLLTYGAQDVSPHDSGAYTGDISAPMLAKLGCTYVVVGHSERREYHGETDELVNKKVRA
ALKHGLSPIVCVGEQLEVREAGGHIEHTTSQLIAALKGLKTEQVNNVVVAYEPVWAIGTG
RVATPSDAEEVCAALRTALADKYGADLAQRVRVLYGGSVKSSNVADLVKCDNVDGALVGG
ASLDGEEFTKLCALAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcaagccgctgatcgcaggcaactggaagatgaatctgaaccacctcgaggcc
atcgccctggttcagaagatcgccttctcgttgccggagaagtactacgagaaggtcgat
gtgacggtgcttccgccgttcaccgacatccgtagcgtgcagacactggtcgacggggac
aagctcctgctcacctacggggctcaggacgtgtcgccgcacgactccggtgcctacacc
ggcgacatctccgctccgatgctcgccaagctgggctgcacctatgtcgtggtcggccac
tccgagcggcgcgagtaccacggcgagaccgacgagctcgtgaacaagaaggtccgtgcc
gcgctcaagcacgggctgtcgccgatcgtgtgtgtcggcgagcagttggaggttcgggaa
gccggcggtcacatcgagcacaccacgtctcagctcatcgcggcgctgaaggggctcaag
accgaacaggtgaacaacgtggtggtggcctatgaacccgtgtgggccatcggcacgggc
cgtgtcgccaccccttccgacgccgaagaggtgtgtgccgcgttgcggacggcgctggcc
gacaagtacggtgccgacctcgcccagcgggtgcgggtgctctacggtggctcggtgaag
tcgagcaacgtggccgacctcgtcaagtgtgacaacgtcgacggagctctcgtgggtggt
gccagcctcgacggtgaggagttcacgaaactgtgtgctctcgcggcgggtggcccacta
ccgtga

DBGET integrated database retrieval system