KEGG   Saccharomonospora viridis: Svir_20250Help
Entry
Svir_20250        CDS       T00980                                 

Definition
(GenBank) benzaldehyde dehydrogenase (NAD+)
  KO
K00141  benzaldehyde dehydrogenase (NAD) [EC:1.2.1.28]
Organism
svi  Saccharomonospora viridis
Pathway
svi00622  Xylene degradation
svi00623  Toluene degradation
svi00627  Aminobenzoate degradation
svi01100  Metabolic pathways
svi01120  Microbial metabolism in diverse environments
svi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Svir_20250
   00623 Toluene degradation
    Svir_20250
   00622 Xylene degradation
    Svir_20250
Enzymes [BR:svi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.28  benzaldehyde dehydrogenase (NAD+)
     Svir_20250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ACU97043
UniProt: C7MVU3
Position
complement(2160085..2161545)
Genome map
AA seq 486 aa AA seqDB search
MTASTAGPVGDSPTRWSSSAATGGTLTVTAPATGSVLAEVDAASPADVDRAVAKAKQAQR
DWAATTYDQRAAVLRRAARLLEADPDRLRRWLVPESGSAMGKASFEVGLVVSELDECAAL
ASHPYGELLHSTKPRLSLARRVPVGVVGVISPFNFPGILSMRSVAPALAVGNAVVLKPDP
RTPISGGLALAELLAEAGLPDGLLTVLPGGAEVGQALVAHPDVPCISFTGSTPAGRKIAE
AAAPLLKRVHLELGGNNALLVLPDADVEAAASAAAWGSFLHQGQICMTAGRHLVHSSIAD
EFTALLAKKAEAITVGDPTDENNALGPIIDERQREQIHRIVTDTVDAGAKLLAGGKYDGL
FYRPTVLGNVPVDSPAFRQEIFGPVAPVVTYDTVDEAIELINDSEFGLSVGILTSDAFRA
YELADRIESGMVHINDQTVDDEATIPFGGVKASGAGGRFGGARANLESFTEIQWITMQSS
IERYPF
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
gtgacagctagtacagccggtccggtcggtgacagccccactcgctggtcttcctcggcg
gccacgggcggtactttgacggtgacggcgcctgccacgggcagtgtcctcgccgaggtc
gacgcggcttcccccgccgatgtcgaccgtgccgtcgccaaggcgaagcaggcccagcgg
gactgggccgccaccacctacgaccagcgcgccgcggtgctgcggcgggccgctcgactg
ttggaagccgaccccgaccggttgcgccgttggctcgtccccgaatcgggttcggcgatg
ggcaaggcgtcgttcgaggtcggcctggtggtctcggaactcgacgaatgcgcggcgctg
gcctctcatccctacggtgaactgctgcactccaccaaaccgcgcctgtcgctggcacgt
cgcgtaccggtcggcgtggtgggggtgatctcgccgttcaacttccccggaatcctgtcg
atgcggtccgtcgcgcccgcgttggcggtgggcaacgccgtggtgttgaaacccgatccc
cgcacgccgatctcgggtggtctcgcgctcgccgagctgctcgccgaggcggggttgccc
gacgggttgctcaccgtgttgcccggcggcgcggaggtcggacaggcgctggtggcccac
cccgacgtgccgtgcatctcgttcaccggatccaccccggccggacgcaagatcgcggag
gccgccgcgccgctgctcaagcgcgtgcacctggaactcgggggcaacaacgcactactc
gtgctcccggacgccgacgtcgaagccgccgcctcggccgccgcgtggggttcgttcctg
caccagggacagatctgcatgacggcggggcggcacctcgtgcactcgtcgatcgcggac
gagttcacggcgttgctcgcgaagaaggccgaggccatcaccgtcggagacccgacggac
gagaacaacgcactcggcccgatcatcgacgaacggcagcgggagcagatccaccgcatc
gtgaccgacacggtggacgcgggcgcgaaactgctcgccggagggaagtacgacggcctg
ttctaccggccgacggtcctggggaacgtcccggtcgacagcccggcgttccggcaggag
atcttcggtccggtggcccccgtggtcacgtacgacaccgtggacgaggcgatcgagctc
atcaacgacagcgagttcggcctcagcgtcggcatcctgacctccgacgcgttccgggca
tacgagctcgcggaccggatcgagtcgggcatggtccacatcaacgaccagacggtcgac
gacgaggccacgatcccgttcggtggcgtgaaggcctccggggcgggcggccgcttcggt
ggtgcgcgggccaacctggagtcgttcaccgagatccagtggatcacgatgcagtcgtcg
atcgagcgttatccgttctga

DBGET integrated database retrieval system