KEGG   Saccharomonospora viridis: Svir_26960Help
Entry
Svir_26960        CDS       T00980                                 

Definition
(GenBank) theronine dehydrogenase-like Zn-dependent dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
svi  Saccharomonospora viridis
Pathway
svi00625  Chloroalkane and chloroalkene degradation
svi00680  Methane metabolism
svi01100  Metabolic pathways
svi01120  Microbial metabolism in diverse environments
svi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Svir_26960
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Svir_26960
Enzymes [BR:svi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Svir_26960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc Glu_dehyd_C AlaDh_PNT_C HI0933_like ADH_zinc_N_2 FAD_oxidored DUF1244
Motif
Other DBs
NCBI-ProteinID: ACU97680
UniProt: C7MUK4
Position
complement(2905862..2906980)
Genome map
AA seq 372 aa AA seqDB search
MVYKGPNEVQVEEVEDPKLEAPTDVIVRVTTTAICGSDLHMYEGRTAAEPGIVFGHENMG
VIEEVGPGVTGLRKGDRVVMPFNIACGFCRNCLAGKTGFCLTVNPGFAGGAYGYVGMGPY
KGGQAEYLRVPFADFNCLKLPPGEEHEDDFAMLADIFPTGYHATELAGVSPGDTVAVYGG
GPVGLMAAYSSILRGASRVFVVDKVPDRLRVAQEIGATPIDFTKGSAPEQIVDLTDGGVD
RGIDAVGYQATVPEGEEQPAAVLNDLIETVRPTGSLGVVGLYVPKDPGGPTEEARSGKLL
INIGKLFEKGLRMGTGQSNVKAYNRQLRDLIIAGRAEPSFVVSQRRPLDEAPDAYARFDR
REPGYTKVVLKP
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
gtggtgtacaagggtcctaacgaggttcaggtggaggaggtcgaggacccgaagctcgaa
gcaccgaccgacgtgatcgtgcgggtcaccacgaccgcgatctgcggctccgacctccac
atgtacgaggggcggacggccgccgaacccgggatcgtgttcggccacgagaacatgggc
gtgatcgaggaggtcggtccgggcgtcaccggtctgcggaagggcgaccgggtcgtgatg
ccgttcaacatcgcctgtgggttctgccgtaactgtcttgcggggaagaccgggttctgt
ttgacggtgaaccccggattcgccggcggagcctacggttacgtcggcatgggcccgtac
aagggcggtcaggccgagtacctgcgggtgccgttcgcggacttcaactgtctgaagctc
ccgcccggtgaggagcacgaggatgacttcgcgatgttggccgacatcttccccaccggc
tatcacgcgacggagctcgccggggtgtcgccgggtgacaccgtcgccgtgtacggcgga
gggcccgtcgggctgatggcggcgtactcgtcgatcctgcgtggtgcttcgcgggtgttc
gtggtggacaaggtgcccgaccggttgcgggtggcccaggagatcggggcgaccccgatc
gatttcaccaagggcagtgcgcccgaacagatcgtcgatctcacggacggcggtgtggac
agagggatcgacgccgtcgggtaccaggccacggttcccgagggtgaggagcagcccgcc
gcggtgctcaacgatctcatcgagacggtgcgacccaccggatcgctgggtgtggtcggg
ctgtacgtgcccaaggaccccggcgggccgacggaggaggcccgcagcggcaagctgctc
atcaacatcggtaagctcttcgagaagggactgcgtatgggcaccgggcagtccaacgtg
aaggcgtacaaccggcagttgcgcgatctcatcatcgcggggagggccgagccgagcttc
gtggtgtcgcagcggcgtcccctggacgaggcacccgatgcctatgcccggttcgaccgg
cgcgagccgggttacaccaaggtcgtcctcaagccgtga

DBGET integrated database retrieval system