KEGG   Saccharomonospora viridis: Svir_29950Help
Entry
Svir_29950        CDS       T00980                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
svi  Saccharomonospora viridis
Pathway
svi00260  Glycine, serine and threonine metabolism
svi00750  Vitamin B6 metabolism
svi01100  Metabolic pathways
svi01110  Biosynthesis of secondary metabolites
svi01120  Microbial metabolism in diverse environments
svi01230  Biosynthesis of amino acids
Module
svi_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Svir_29950
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Svir_29950
Enzymes [BR:svi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Svir_29950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACU97973
UniProt: C7MX56
Position
complement(3237378..3238472)
Genome map
AA seq 364 aa AA seqDB search
MNAQASSAAGQGVRPGWPGVIKAYASRIPIPEGAEIVTLGEGNTPLLFAPHLSELTGCTV
YLKVEGANPTGSFKDRGMTVAITHAKASGVQAVICASTGNTSASAAAYATRAGLTTAVLV
PQGKIAMGKMAQAVLYGARILQIDGNFDDCLELARKMAADYPVTLVNSVNPVRLVGQKSA
AWEICDALGQAPDIHCLPVGNAGNITAYWAGYTEYAADKVISTVPRMFGFQAAGAAPLVK
GEPVPNPETVATAIRVGSPASWDSAVQAKTASGGLFEAVTDERILEAYRLLARREGVFVE
PASATSVAGLLLTAADGRLPKGSTVVCTVTGHGLKDPATALEGNVEVEPLAVDPSAVAAA
LELS
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgcgcaggcttcttcggctgcggggcagggtgtgcggccgggctggccgggtgtc
atcaaggcgtatgcctcgcgcatcccgatccccgagggcgctgagatcgtcacgctcggg
gagggcaacacaccactgctgttcgcgccgcacctgtccgagctcaccgggtgcaccgtg
tacctgaaggtggagggtgccaaccccacggggtcgttcaaggaccgggggatgacggtg
gcgatcacccacgccaaggcgagcggggtgcaggccgtcatctgcgcctccaccgggaac
acgtccgcgtcggcggccgcctacgccacccgggcgggtctgaccacggcggtgctggtg
ccgcagggcaagatcgcgatggggaagatggcgcaggccgtgctgtacggggcacgcatc
ctccagatcgacggcaatttcgacgactgtctggagttggcgcgcaagatggccgccgac
tacccggtcacgctggtcaactcggtgaacccggtgcggttggtggggcagaagagcgcg
gcgtgggagatctgtgacgcgctcggtcaggccccggacatccattgccttccggtgggc
aatgcgggcaacatcaccgcctattgggcggggtacaccgagtacgccgcggacaaggtg
atcagcacggtgccgcgcatgttcggcttccaggccgccggtgccgcaccgctggtgaag
ggcgagcccgtgccgaacccggagacggtggccaccgcgatccgggtgggcagcccggcg
tcgtgggattcggcggtgcaggccaaaacggccagcggtgggttgttcgaggcggtgacc
gatgagcggatcctcgaggcctaccggctgctcgcccggcgtgagggggtgttcgtggag
cccgcctccgcgacgagcgtggcgggcctgttgttgacggcggccgacgggcgattgccg
aaggggtccaccgtcgtgtgcacggtcaccggacacgggctgaaggatcccgcgaccgcc
ctggagggcaacgtggaggtcgagccgctcgccgtcgacccgagtgcggtcgcggcggca
ctggaactgtcgtag

DBGET integrated database retrieval system