KEGG   Saccharomonospora viridis: Svir_31680Help
Entry
Svir_31680        CDS       T00980                                 

Definition
(GenBank) choline/carnitine/betaine transport
Organism
svi  Saccharomonospora viridis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BCCT
Motif
Other DBs
NCBI-ProteinID: ACU98141
UniProt: C7MYQ2
Position
complement(3434252..3435856)
Genome map
AA seq 534 aa AA seqDB search
MSDSGEHKLAKDSPKINRVTFVGASSIILVIALWGIIAPENAAETIGVLVNWVSEGLGWY
YILLATVILVFVVIVAVSKYGKITLGPVESKPDYNLFTWGAMLFAAGIGIDLMFFSVSEP
VTQYLQPPQVEPESLEATRDAVVWALFHYGITGWAMYALMGMTLGYFAFRRGLPLAVRAA
LYPIIGKRIHGRPGHAVDIAAALGTVFGVATSLGIGVVQLNFGLNFMFGIPQGTAAQIGL
IVLAVLMATMSAVSGVDRGIRRLSQLNVILAAALMLFVLFADNPVYLLDALVLNIGDYIA
NFGDMTLNTFAYDRPTEWLNSWTLFFWAWWIAWAPFVGLFLARISWGRTIREFVAATLII
PFMFTATFLSVFGNSALRLVREGNEEFGQVAANTPEQGFYTLLAQYPGVTFSAGLATVVG
LLLYVTSADSGALVLGNLTSKLSTSTAEATSGVRVFWSAVIGVLTLAMLIVGGVGTLQNA
TIIMGLPFSVVMVLVMWGLYKALRQEGQGTDQFLPAGGSEGKSDAESERVAAKR
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgatagcggcgaacataagctcgcgaaggacagtcctaagatcaatcgcgtcacg
ttcgtcggagcgtcgtcgatcatcctcgtgatcgccctgtgggggatcatcgctccggag
aacgccgcggaaaccatcggtgtcctcgtcaactgggtttcggaaggactcggctggtac
tacatcctgctcgccacggtgatactcgtgttcgtggtgatcgtggccgtgtccaagtac
ggcaagatcaccctcgggccagtggagtccaaaccggactacaacctcttcacctggggt
gcgatgctgttcgccgcgggcatcggcatcgacctcatgttcttctcggtctccgagccg
gtgacgcagtatctgcagcccccgcaggtggaaccggagtcgctcgaagccacccgggac
gccgtggtgtgggcgctgttccactacggtatcaccggctgggccatgtatgcgctcatg
ggaatgacgctcgggtacttcgcgttccggcgcggcctgccgttggccgtccgagcggcg
ctgtacccgatcatcggtaagcgcatccacggccgtcccggccacgcggtggacatcgcc
gccgccctgggcacggtgttcggcgtcgcgacctcgttgggtatcggcgtggtgcagctg
aacttcgggttgaacttcatgttcggcatcccgcagggcacggcggcgcagatcgggctc
atcgtgctggcggtgctgatggccacgatgtccgccgtgtccggtgtcgacagggggatc
cggcggctgtcgcagctcaacgtgatcctcgcggcggcgttgatgctgttcgtcctgttc
gccgacaacccggtgtacctgctggacgcgttggtgctcaacatcggcgactacatcgcc
aacttcggcgacatgacgctgaacaccttcgcgtacgaccggcccaccgagtggctcaac
tcctggacgctgttcttctgggcctggtggatcgcatgggcaccgttcgtcggcctgttc
ctcgcgcgcatctcgtggggacgcacgatccgggagttcgtggcggcgacgctgatcatc
ccgttcatgttcacggccacgttcctgtcggtgttcggcaacagcgcgctgcgcctggtg
cgagaggggaacgaggagttcggacaggtcgcggcgaacacaccggaacagggcttctac
acgctgttggcgcagtacccgggcgtgacgttcagcgcgggcctggccacggtggtcggg
ttgctgctttatgtcacctccgccgactcgggcgctctggtgttgggaaacctgacgtcg
aaactgtcgacgtccaccgccgaggccacgtcgggggtccgggtgttctggtccgccgtc
atcggtgtgctgaccttggcgatgctcatcgtcggcggggtcgggacgcttcagaacgcc
accatcatcatggggctgccgttctcggtggtgatggtgctggtgatgtggggcttgtac
aaggcgctacgccaggaaggacagggcaccgaccagttcctgccggcgggtgggtccgag
ggcaagtccgacgccgagtccgaaagggtcgccgcgaaacggtga

DBGET integrated database retrieval system