KEGG   Saccharomonospora viridis: Svir_32440Help
Entry
Svir_32440        CDS       T00980                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
svi  Saccharomonospora viridis
Pathway
svi00900  Terpenoid backbone biosynthesis
svi01100  Metabolic pathways
svi01110  Biosynthesis of secondary metabolites
svi01130  Biosynthesis of antibiotics
Module
svi_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:svi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Svir_32440
Enzymes [BR:svi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Svir_32440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ACU98215
UniProt: C7MZI6
Position
complement(3518826..3519752)
Genome map
AA seq 308 aa AA seqDB search
MLAAVPPPVTVRVPSKINLHLSVGDVRDDGYHELTTVFQALSLTDEVTALAGGDSGVEVS
GEGARSVPKNEDNLAVRAVRALAEHVGRPERAERVRLVIRKGIPVAGGMAGGSADAAGAL
LACSILWGLDLHRDELAEVAATLGSDVPFALYGGTALGTGRGEQLVPVLSRHTFHWVLAF
DQRGLSTPKVYGELDRLREAGDPPRVGAPEALLEALASGDPHRLAPLLGNDLQAAAISLR
PGLRRTLRAGVTAGALAGVVSGSGPTCAFLCSDADSALKVAAELAGAGVCRTVRVAHGPV
PGARVHEE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgcttgccgccgtaccaccgcccgtgaccgtgcgagtgccgtcgaagatcaacctgcat
ctgtccgtgggtgacgtgcgggacgacggctatcacgagctgaccacggtgttccaggcg
ctgtcactgaccgacgaggtgaccgcactggcgggcggggactccggcgtcgaggtgtcc
ggtgagggtgcccggtcggtgccgaagaacgaggacaacctcgccgtgcgggccgtacgc
gcactggccgaacacgtaggacggccggagagggccgagcgggtacgccttgtgatccgt
aagggcatccccgtggccggggggatggccggggggagcgccgacgccgcgggcgcgctc
ctggcgtgctcgatcctgtgggggctggacctgcaccgtgacgaactcgccgaggtggcc
gccaccttgggcagcgacgtgccgttcgcgctctacgggggcacggcgttgggtaccgga
cggggcgaacaactcgtgcccgtgttgtcgcggcacaccttccactgggtgttggcgttc
gaccagcgtggtctgtccacgccgaaggtgtacggggaactcgaccggctgcgtgaggcg
ggtgacccgcccagggtcggcgcgcccgaggcgttgttggaggcgctcgcgtccggtgat
ccgcaccggctcgcgccgctgctcggcaatgacctccaggccgcggctatatcgctgagg
ccggggctgcgccgtacgttgcgtgccggggtcaccgcgggtgcgctcgcgggtgtggtg
tcgggttccggtccgacgtgtgcgttcctgtgctccgacgccgactcggcgctgaaagtg
gccgccgagctggcgggcgccggcgtgtgtcgcacggtccgggtcgcacatggtccggtg
cccggcgcgcgcgtgcacgaggagtga

DBGET integrated database retrieval system