KEGG   Streptomyces violaceusniger: Strvi_0336Help
Entry
Strvi_0336        CDS       T01602                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
svl  Streptomyces violaceusniger
Pathway
svl00450  Selenocompound metabolism
svl00970  Aminoacyl-tRNA biosynthesis
svl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:svl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Strvi_0336
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Strvi_0336
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:svl01007]
    Strvi_0336
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:svl03016]
    Strvi_0336
Enzymes [BR:svl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Strvi_0336
Amino acid related enzymes [BR:svl01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Strvi_0336
Transfer RNA biogenesis [BR:svl03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Strvi_0336
 Prokaryotic type
   Other AARSs
    Strvi_0336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1 NUFIP1 HHH_8
Motif
Other DBs
NCBI-ProteinID: AEM80124
UniProt: G2PB72
Position
complement(101500..103233)
Genome map
AA seq 577 aa AA seqDB search
MARHLITSALPYINGIKHLGNMVGSMLPADVYSRYMRQRGHDVLYICATDEHGTPAELAA
KEAGLPVDEFCAQQHEAQKAIYDGFGLAFDYFGRSSSAQNVQITQTIARELKANGFIEER
SIRQVYSNADGRFLPDRYIEGTCPHCGYDKARGDQCENCTRVLDPTDLIDARSAISGSSD
LEVRETKHLFLLQSKLAEEVASWVDERGKDWPTLASSIARKWLNEGLQDRAITRDLDWGV
PVPADTWPELAAEGKVFYVWFDAPIEYIGATKEWADLDPENRDWKSWWYDVDETVRYTEF
MAKDNVPFHTVMFPATLLGTRDAWKKVDYVKAFNWLTYYGGKFSTSQKRGVFTDAALEVL
PADYWRYFLMANAPESDDTSFTWEHFTATVNKDLADTLGNFVNRVLSFSRKRFGDEVPAG
QAAGEAEERLGEEIARLLAEYEEHMDALQFRKAAAALRALWSAGNSYLEEKAPWLEIKTD
QEAAALTLRTAMNLIHLYAIVSEPFIPSSARAMRSAFALSEDTAVWVGQEEAKALASVPA
GTAFTVPPVLFAKITEEDLESFRERFGGAEQNGNGAA
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggctcgacacctcatcaccagcgcccttccctacatcaacgggatcaagcacctgggc
aacatggtggggtccatgctcccggccgacgtctactcccgctatatgcgccagcgcggc
catgacgtcctctacatctgcgccaccgatgagcacggcacccccgccgagctggccgcc
aaggaggccgggctgccggtcgacgagttctgcgcccagcagcacgaggcgcagaaggcg
atctacgacggcttcgggctcgccttcgactacttcggccgcagctcctccgcgcagaac
gtgcagatcacccagacgatcgcacgtgagctcaaggcgaacggcttcatcgaggagcgc
tcgatccgccaggtgtactccaacgccgacggccgcttcctccccgaccgctatatcgag
ggcacctgtccgcactgcggctacgacaaggcccgcggcgaccagtgcgagaactgcacc
cgcgtgctcgacccgaccgacctgatcgacgcccgctccgcgatcagcggcagcagcgat
ctggaggtccgggagaccaagcacctcttcctcctccagtccaagctggcggaggaggtc
gcctcctgggtcgacgagcgcggcaaggactggccgacgctggcctcctcgatcgcccgc
aagtggctgaacgaggggctgcaggaccgggcgatcacccgcgacctggactggggcgtg
ccggtgccggccgacacctggccggagctggcggccgagggcaaggtcttctacgtctgg
ttcgacgcgccgatcgagtacatcggggccaccaaggaatgggcggatctggacccggag
aaccgcgactggaagtcgtggtggtacgacgtggacgagaccgtccgctacaccgagttc
atggccaaggacaacgtcccgttccacaccgtgatgttcccggccaccctcctcggcacc
cgggacgcctggaagaaggtcgactacgtcaaggcgttcaactggctgacgtactacggc
gggaagttctccacctcccagaagcgcggggtgttcaccgacgccgcgctcgaggtgctg
cccgccgactactggcgctacttcctgatggcgaacgccccggagtccgacgacacctcc
ttcacctgggagcacttcaccgccaccgtcaacaaggacctggccgacactctcggcaac
ttcgtcaaccgcgtgctgtccttctcccgcaagcggttcggggacgaggtcccggccggg
caggccgccggggaggcggaggagcgcctgggcgaggagatcgcgcggctgctggcggag
tacgaggagcacatggacgcgctccagttccgcaaggccgcggcggcgctgcgcgccctg
tggagcgcgggcaactcctacctggaggagaaggccccctggctggagatcaagaccgac
caggaggccgcggccctcaccctgcgtacggcgatgaacctcatccacctctacgcgatc
gtctccgagccgttcatcccgtcctcggcacgggccatgcggtcggcgttcgcgctgagc
gaggacaccgcggtctgggtcggccaggaggaggcgaaggcgctggcgtcggttccggcg
ggcacggccttcaccgttcccccggtgctcttcgcgaagatcaccgaggaggacctggag
tccttccgggagcgcttcggcggtgcggagcagaacgggaacggcgccgcgtag

DBGET integrated database retrieval system