KEGG   Streptomyces violaceusniger: Strvi_1272Help
Entry
Strvi_1272        CDS       T01602                                 

Definition
(GenBank) mycothiol conjugate amidase Mca
  KO
K18455  mycothiol S-conjugate amidase [EC:3.5.1.115]
Organism
svl  Streptomyces violaceusniger
Brite
KEGG Orthology (KO) [BR:svl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Strvi_1272
Enzymes [BR:svl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.115  mycothiol S-conjugate amidase
     Strvi_1272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIG-L
Motif
Other DBs
NCBI-ProteinID: AEM81023
UniProt: G2PBV1
Position
1101912..1102784
Genome map
AA seq 290 aa AA seqDB search
MTEQLRLMAVHAHPDDESSKGAATMAKYVSEGVDVLVATCTGGERGSILNPKLQGDPYIE
ANIHEVRAKEMDEAREILGVKQEWLGFVDSGLPEGDPLPPLPEGCFALQDVEAAAEPLVR
LIRSFKPQVITTYDENGGYPHPDHIMTHKITMVAFEAAGDPEKYPEAGEPWQPQKLYYNQ
GFNRARTVALHEALLARGLDSPYEEWLERWKTFNRPERTLTTYVPCADFFEIRDKALIAH
RTQIDPDGGWFRVPMDVQREVWPTEEYELAKSLVDTSLPEDDLFAGIRNN
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
ttgactgagcagctgcgtttgatggccgtgcatgcgcaccccgatgacgagtcgagcaag
ggcgcggccaccatggccaagtacgtgtctgagggggtggacgtgctggtcgcgacctgc
acaggtggagagcgcggctccatcctcaatcccaagctccagggtgatccctacatcgag
gcgaacattcacgaggtccgcgccaaggagatggacgaggcgcgcgagatcctcggcgtc
aagcaggagtggctgggctttgtggactccggactccccgagggcgatccgctgccgcca
ctgcccgagggctgcttcgcactgcaggacgtcgaggcagcggcggagcccctggtgcgg
ctgatccgctcgttcaagccgcaggtgatcaccacctatgacgagaacggcggctatccc
caccccgaccacatcatgacccacaagatcacgatggtggccttcgaggcggccggtgac
cccgagaagtacccggaggcgggggagccctggcagccgcagaagctctactacaaccag
ggcttcaaccgggcgcgcaccgtcgccctgcatgaggcgctgctggcccgcgggctggac
tcgccgtacgaggagtggctggagcgctggaagaccttcaaccggcccgagcgcaccctg
accacctatgtgccctgcgccgacttcttcgagatccgcgacaaggcgctgatcgcgcac
cgtacgcagatcgatcccgatggcggctggttccgggtgcccatggacgtccagcgggag
gtctggcccaccgaggagtacgagctcgccaagtcacttgtggacacttccctccccgag
gacgacctcttcgcgggcatccgcaacaattga

DBGET integrated database retrieval system