KEGG   Streptomyces violaceusniger: Strvi_1368Help
Entry
Strvi_1368        CDS       T01602                                 

Definition
(GenBank) ROK family protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
svl  Streptomyces violaceusniger
Pathway
svl00010  Glycolysis / Gluconeogenesis
svl00520  Amino sugar and nucleotide sugar metabolism
svl01100  Metabolic pathways
svl01110  Biosynthesis of secondary metabolites
svl01120  Microbial metabolism in diverse environments
svl01130  Biosynthesis of antibiotics
svl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Strvi_1368
   00520 Amino sugar and nucleotide sugar metabolism
    Strvi_1368
Enzymes [BR:svl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Strvi_1368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK DUF4574
Motif
Other DBs
NCBI-ProteinID: AEM81117
UniProt: G2PDF9
Position
1218919..1219710
Genome map
AA seq 263 aa AA seqDB search
MTQDQGATGASAAKVFGIDIGGSGIKGAPVDLNRGELVEERHKVLTPHPSTPEAVLDGVV
EVVRHFDWSGRPVGVTFPGVVKNGVTLTAANVDKSWIGTDLASQLGERLDCPVTVLNDAD
AAGVAEVAFGAARGVKGTVIVLTLGTGIGSALFTDGHLLANTELGHLELDGHEAEKRAST
KVKDDHELSWSHWARRVQKYLHHLEMLFSPERFVLGGGVSRKADKFLPLIEGVRAEIVPA
QLQNNAGIVGAAMAAAAAADDAG
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcaggaccagggggccacgggggcgtccgcggcgaaggtgttcggcatcgacatc
ggcggttcgggcatcaagggcgccccggtggacctgaaccggggcgagctcgtggaggag
cgccataaggtcctcaccccgcacccgtccacgcccgaggcggtcctggacggtgtggtg
gaggtcgtccggcatttcgactggtccgggcggccggtcggggtgaccttcccgggcgtg
gtgaagaacggtgtcacccttaccgccgcgaatgtcgacaagagctggatcggcaccgat
ctggcgtcacagctcggcgagcggctggactgccccgtcacggtgctgaacgacgcggac
gcggccggggtcgcggaggtggccttcggcgccgcccgtggcgtcaagggcaccgtgatc
gtgctcaccctcggcaccggcatcggcagcgcgctcttcaccgacgggcatctgctggcc
aacaccgagctgggccatctggagctggacggccacgaggcggagaagcgggcctcgacc
aaggtcaaggacgatcacgagctgagctggtcgcactgggcgcgccgggtgcagaagtac
ctccatcacctggagatgctcttctcaccggagcgcttcgtgctgggcggcggggtgagc
cgtaaggcggacaagttcctgccgctgatcgagggcgtcagggccgagatcgtgcctgcg
cagctgcagaataacgcggggatcgtgggtgccgcgatggccgcggccgctgctgccgac
gacgccgggtga

DBGET integrated database retrieval system