KEGG   Streptomyces violaceusniger: Strvi_3976Help
Entry
Strvi_3976        CDS       T01602                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
svl  Streptomyces violaceusniger
Pathway
svl00010  Glycolysis / Gluconeogenesis
svl00620  Pyruvate metabolism
svl00640  Propanoate metabolism
svl00680  Methane metabolism
svl01100  Metabolic pathways
svl01110  Biosynthesis of secondary metabolites
svl01120  Microbial metabolism in diverse environments
svl01130  Biosynthesis of antibiotics
svl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Strvi_3976
   00620 Pyruvate metabolism
    Strvi_3976
   00640 Propanoate metabolism
    Strvi_3976
  Energy metabolism
   00680 Methane metabolism
    Strvi_3976
Enzymes [BR:svl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Strvi_3976
Lipid biosynthesis proteins [BR:svl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Strvi_3976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEM83635
UniProt: G2NZL2
Position
4318800..4320434
Genome map
AA seq 544 aa AA seqDB search
MTSPEQRMADLLKTFGEPAANTAYLLCDRHPDDAVAFTVVGKDLTGHDMTYGELRDRSSR
MAGALAALGVGVGDRVATLMGKSADLLIATLAIWRLGAVQVPLFTAFAPPAIALRIAGNA
TKVVISDADQRPKLDPESGFPGERPWRIVTTGPVTGSDLSFAELAEGDATLPEPVAVGGD
GLIVELFTSGTAGTPKAVPIPLRAVAGFAMYQQFGLDHRPTDVFWNAADPGWAYGLYYAL
IGPLALGQRALLLNGLFSAESTWEVLSRFGVTNFTAGPTVYRKLRASGIPAPGDLRLRCC
SAAGEPLPPDVVDWALETLGVPVRDHYGSTELGMVIAHAWHPSLRDDIKPGSMGRPLPGW
RVKVLREDTNSALARVDIPGRVVVDIEDSPLMWFKGYLDAPEQTAEKFSPDGRWFYTGDT
ASRDEEGDLFFSGRGDDIILMAGYRIGPFEVETVLLEHAAVAEAAVVGVPDEEYGEVVEA
FIVPRPGTEADDALAAELQQLVRERYAKHAYPRNVHFVTELPKTSSGKTQRFLLRPQQPS
PRRP
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
ttgaccagcccggaacagcgcatggctgacctgctcaagaccttcggtgagcctgcggcg
aacaccgcgtacctgctgtgcgacaggcacccggacgacgccgtcgcgttcacggtggtg
ggcaaggacctgaccggccacgacatgacgtacggggagctgcgggaccgttcgtcgcgg
atggccggtgccctggccgccctgggagtcggagtgggcgaccgcgttgccaccttgatg
ggcaaatccgccgacctgctgatcgcgaccctggcgatctggcggctcggggccgtccag
gtgccgctgttcaccgcgttcgccccgccggccatcgcgctgcggatcgcgggcaacgcc
accaaggtcgtgatcagcgacgccgaccaacgccccaagctggacccggagtcgggcttc
cccggcgagcgcccctggcggatcgtcaccaccgggcccgtcaccgggtccgacctgtcc
ttcgcggaactggccgagggagacgccacgctgcccgagccggtggccgtgggcggcgac
gggctcatcgtggagctgttcacctcgggtaccgcgggcacccccaaggcagtcccgatc
ccgctgcgggccgtcgcggggttcgcgatgtaccagcagttcggcctggaccaccggccc
accgacgtcttctggaacgccgccgacccgggctgggcgtacggcctgtactacgcgctc
atcgggccgctcgccctcgggcagcgcgcactgctgttgaacggcctgttctccgcggag
tccacctgggaggtgctctcccgcttcggggtcaccaacttcaccgccgggcccaccgtc
taccgcaagctgcgcgcctccggtatccccgcccccggcgatctgcggctgcgctgctgc
tccgcggcgggcgaaccgctgcccccggacgtcgtcgactgggcgctcgagacgctcggt
gtccccgtgcgcgaccactacggctcgaccgagctgggcatggtgatcgcccacgcctgg
cacccgtccctgcgcgacgacatcaagcccggctccatgggccgtccgctgcccggctgg
cgggtgaaggtgctgcgcgaggacaccaactccgcactggcccgggtggacatccccggc
cgggtcgtggtggacatcgaggacagcccgctgatgtggttcaagggctacctcgacgcc
cccgagcagaccgccgagaagttcagccccgacgggcgctggttctacaccggtgacacc
gcctcccgcgacgaggagggcgatctgttcttctccgggcgcggcgacgacatcatcctg
atggcgggctaccgcatcggccccttcgaggtggagaccgtgctgctggagcacgccgcg
gtggcggaggccgccgtggtcggcgtaccggacgaggagtacggcgaggtcgtggaggcg
ttcatcgtgccgcgaccggggacggaggcggacgacgcgctcgcggccgagctgcagcag
ctcgtcagggagcggtacgccaagcacgcctatccgcggaacgtccacttcgtgaccgag
ctgccgaagacctccagcggtaagacgcagcggttcctgctgcgtccgcagcagccctcg
ccccggcgcccctga

DBGET integrated database retrieval system