KEGG   Streptomyces violaceusniger: Strvi_4901Help
Entry
Strvi_4901        CDS       T01602                                 

Definition
(GenBank) permease for cytosine/purines uracil thiamine allantoin
Organism
svl  Streptomyces violaceusniger
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transp_cyt_pur
Motif
Other DBs
NCBI-ProteinID: AEM84455
UniProt: G2P563
Position
5444303..5445799
Genome map
AA seq 498 aa AA seqDB search
MAVSTTKETEAPEVPGGARHRPVIESRSIDYVPLAERHGKVWHLFPVWFAGDAHLATIAT
GAIGVALGGNLIWTAIAIVLGNALGTFFMAFHSTQGPQLGLPQMVQSRPQFGFVGALLVW
IVALVTYIGYTAFNQVLVGSTMDHLADTPPSVSYIAYAVIGIVLAVVGYDFIHKASRWLT
YLTGAGLAVFSVGIVVVAPFSADQLDLSAFTLAPFLIQLFHAAVYQLSWSIYVSDYSRYL
PPTVGVRSSFWWTYLGAGFGGAWMMLVGAVAAGLFPKLGLVDAVVSAGDQLFSGFGVVLL
LLSVIPLFTIGTLNFYGGSLTLLSSIDSVKRIPLTLGTRIATLVVLGVVSTALAFSANDD
FLTTFGDFLIVLGYLFTPWTAVNLIDFYVVRRGRYSIREIFNPRGIYGRWNWRGLTAYGV
GFVSMLPFAVIGDMEGPLAHWVKGADVTMLVGLAVSSLLYLMLCRSLDIDAERAVIASAD
AGLDPDHAGHQADTGHHA
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcagcaccaccaaggagaccgaggcaccggaggtgccgggcggcgcccggcac
cgcccggtcatcgagagccggtcgatcgactacgtgcccctcgccgaacgccacggcaag
gtctggcacctcttccccgtctggttcgccggggacgcgcatctcgccaccatcgccacc
ggcgcgatcggtgtggcgctcggcggcaacctgatctggacggccatcgccatcgtgctc
ggcaacgctctgggcaccttcttcatggccttccactccacccagggcccgcagctcggg
ctgccgcaaatggtgcagtcccggccgcagttcgggttcgtcggcgcgctgctggtgtgg
atcgtggcattggtgacatacatcggctacacggccttcaaccaggtgctggtcggctcg
acgatggaccacttggcggacactcccccgtcggtcagctatatcgcctacgccgtgatc
ggcatcgtgctcgccgtcgtgggatatgacttcatccacaaggcgtcccggtggctgacc
tacctgacgggcgcgggcctggccgtcttctccgtgggcatcgtggtggtcgcccccttc
agcgcggaccagctcgatctgagcgccttcactctcgctccgtttctgatccagctcttt
cacgccgccgtctaccagctctcgtggtccatctacgtctcggactactcccgctatctt
ccgccgacggtgggggtgcgctcctcgttctggtggacgtatctgggtgcgggcttcggt
ggcgcgtggatgatgctggtgggggcggtggccgcggggctgttcccgaagctgggcctg
gtggatgccgtggtcagcgccggtgaccagctgttttccggtttcggtgtcgtgctgttg
ctgttgtcggtgattccgctgttcaccatcggcaccctcaacttctacggcggcagcctc
acgctgctctccagcatcgactcggtgaagcggatcccgctgactctgggcacccgtatc
gccacactggtggtcctcggcgtggtctccaccgcactcgccttcagtgccaacgatgac
ttcctgaccaccttcggggacttcctgatcgtcctcggctacctcttcacaccgtggacc
gcggtcaacctgatcgacttctatgtggtgcggcgtggccgctactcgatccgcgagatc
ttcaacccccgtggcatctacggccggtggaactggcgcgggctcaccgcctatggcgtc
ggcttcgtctcgatgctgccgttcgccgtgatcggcgatatggaggggccgctcgcgcac
tgggtcaagggggccgacgtcaccatgctggtcggactcgccgtgtcgtccctgctctat
ctgatgctgtgccgctcgctcgacatcgacgccgaacgcgccgtcatcgcgtccgccgac
gccggtctcgacccggaccacgccgggcaccaggcggacaccggacaccacgcatga

DBGET integrated database retrieval system