KEGG   Streptomyces violaceusniger: Strvi_5051Help
Entry
Strvi_5051        CDS       T01602                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
svl  Streptomyces violaceusniger
Brite
KEGG Orthology (KO) [BR:svl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Strvi_5051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AEM84591
UniProt: G2NUJ2
Position
complement(5602987..5604129)
Genome map
AA seq 380 aa AA seqDB search
MDSVSFLLVAVILTALAFDFTNGFHDTANSMATSIATGALSPRIAVGVAAVLNLAGAFLS
TEVAKTISNGIVDDAKVSPVMIFAGLIGAILWNLITWLAGLPSSSSHALFGGLIGAVWVG
AGESAVRFTAIVEKILIPAVASPIVACAVAMLATYLAYVITHRAATPAAGKGFRAGQVGS
ASLVALAHGTNDAQKTMGVITLTLIAGGVLGHGSGPPWWVVLASGVAISLGTYIGGWRII
RTMGKGLTDIQPPQGFAAETSAAAVILASSHLGFPLSTTQVCTGSILGAGLGRRLAHVRW
GIAGRIAVSWLLTLPAAAAVGGVAAWAAGRGNAGVALVAGIAVAAAVGFYALSRRRPVNP
DNVNEPGVPEPAERTLDRTV
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggactccgtctccttccttctggtggccgtcatcctcacggcactggccttcgacttc
accaacggcttccacgacaccgccaattcgatggccacgtccatcgccacgggggcgctg
tcgccccggatcgccgtcggcgtcgccgcagtgctcaatctggccggggcctttctctcc
acggaagtggccaagacgatctccaatggcatcgtcgacgacgccaaggtctccccggtc
atgattttcgcggggctgatcggggcgatcctgtggaatctgatcacctggctcgccggg
ctgccgtcgagttcctcgcacgccctgttcggcgggctgatcggcgcggtgtgggtgggc
gccggggaatctgcggtgcgcttcaccgcgatcgtcgagaagatcctgattccggcggtc
gcctcaccgatagtggcctgtgcggtggccatgctggcgacctatctcgcctacgtgatc
acccaccgggcggccacccccgcggcaggcaagggcttccgcgcgggccaggtgggatcc
gcgtccctggtggccctcgcccacggcaccaatgacgcgcagaagacgatgggggtcatc
acgctcaccctcatcgccggcggtgtgctcggtcacggctccgggcccccgtggtgggtg
gtgctcgcctcgggcgtggcgatctcgctcggcacctatatcggcgggtggcggatcatc
cggaccatgggaaaggggctgaccgacatccagccccctcagggcttcgccgccgagacc
agcgccgccgcggtgatcctggcctcgtcgcatctgggctttcccctctccaccacccag
gtgtgcacgggcagcatcctgggggccgggctcggccgcaggctggcccatgtgcgctgg
gggatcgccgggcggatcgccgtgtcctggctgctgaccctgcccgcggcggcggccgtg
ggaggtgtcgcggcctgggcggccggccggggcaacgcgggggtggccctggtggcgggc
atcgccgtggccgcggcggtgggcttctacgcgctctcgcgccgtcgcccggtgaatccg
gacaacgtgaacgagccgggcgtccccgagcccgccgagcgcaccctcgacaggaccgtc
tga

DBGET integrated database retrieval system