KEGG   Streptomyces violaceusniger: Strvi_5548Help
Entry
Strvi_5548        CDS       T01602                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
svl  Streptomyces violaceusniger
Pathway
svl00071  Fatty acid degradation
svl00280  Valine, leucine and isoleucine degradation
svl00281  Geraniol degradation
svl00310  Lysine degradation
svl00360  Phenylalanine metabolism
svl00362  Benzoate degradation
svl00380  Tryptophan metabolism
svl00410  beta-Alanine metabolism
svl00627  Aminobenzoate degradation
svl00640  Propanoate metabolism
svl00650  Butanoate metabolism
svl00903  Limonene and pinene degradation
svl00930  Caprolactam degradation
svl01100  Metabolic pathways
svl01110  Biosynthesis of secondary metabolites
svl01120  Microbial metabolism in diverse environments
svl01130  Biosynthesis of antibiotics
svl01212  Fatty acid metabolism
Module
svl_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Strvi_5548
   00650 Butanoate metabolism
    Strvi_5548
  Lipid metabolism
   00071 Fatty acid degradation
    Strvi_5548
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Strvi_5548
   00310 Lysine degradation
    Strvi_5548
   00360 Phenylalanine metabolism
    Strvi_5548
   00380 Tryptophan metabolism
    Strvi_5548
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Strvi_5548
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Strvi_5548
   00281 Geraniol degradation
    Strvi_5548
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Strvi_5548
   00627 Aminobenzoate degradation
    Strvi_5548
   00930 Caprolactam degradation
    Strvi_5548
Enzymes [BR:svl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Strvi_5548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: AEM85069
UniProt: G2P5N8
Position
complement(6328967..6330067)
Genome map
AA seq 366 aa AA seqDB search
MTDSVTDRVTDSVTDSAIDDDAVLTRTEGRAGHLTLNRPRALNALTPPMVTRIAEALTDW
ERDPAVQAVVIGGAGERGLCAGGDIRMIHRDVTSGGGAASMAFWRDEYTLNARIARYPKP
YVALMDGIVMGGGVGVSAHGSVRIVTERSRVAMPETTIGFVPDVGGTYLLSRAPGELGTH
LALTGAWVGAADALRCGLADHVVPSELLPALTRDLAADPMPDVLPRYAVEAPAGALDGQR
EWIDHCYAADTVEEIVDRLMAVGEPAAKETAETLLAKSPTALKVTLAAVRGARALDSLER
VLEQEYRVSCAALSRPDFVEGVRAQVIDKDRRPRWTPAALTEVTDAEVAGFFAPPADGDL
RLADTP
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgactccgtgaccgaccgcgtgaccgactccgtgaccgactccgcgatcgacgac
gacgccgtgctgacgcgcaccgagggccgcgccggacatctcaccctcaaccgcccccgc
gccctcaacgccctcacccctccgatggtgacccggatcgccgaggccctcaccgactgg
gagcgggacccggccgtccaggccgtggtgatcggcggggcgggggagcgcgggctgtgc
gccggcggcgacatccgcatgatccatcgggatgtgacctcgggcgggggcgcggcctcg
atggcgttctggcgcgacgagtacacgctcaacgcccggatcgcccgctaccccaagccg
tatgtggccctgatggacggcatcgtgatgggcgggggcgtcggggtctcggcccatggc
agcgtgcggatcgtcaccgagcgctcccgggtggccatgcccgagaccacgatcggcttc
gtaccggacgtcggcggcacctatctgctgtcccgcgcaccgggcgaactggggacgcat
ctggcgctcacgggagcgtgggtgggcgccgccgacgcgctgcggtgcgggctggccgac
catgtcgtcccctccgaactgctgcccgcgctgacccgggacctggccgcggacccgatg
ccggacgtccttccccggtacgcggtggaggccccggccggggccctggacggccagcgg
gagtggatcgaccactgctacgcggcggacaccgtcgaggagatcgtggaccggctgatg
gccgtcggggaaccggccgccaaggagacggccgagacccttctcgccaagtcccccacg
gcgctgaaggtcacgctggccgccgtgcgcggggcccgggcgctcgattcgctggagcgc
gtcctggagcaggagtaccgcgtctcgtgcgcggccctgtcccgcccggacttcgtcgag
ggcgtccgcgcccaggtgatcgacaaggaccgccgcccccgctggaccccggccgctctg
accgaggtcaccgacgcggaggtggccggcttcttcgcaccgcccgccgacggcgacctc
cgcctcgccgacaccccgtag

DBGET integrated database retrieval system