KEGG   Streptomyces violaceusniger: Strvi_7032Help
Entry
Strvi_7032        CDS       T01602                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
svl  Streptomyces violaceusniger
Pathway
svl00010  Glycolysis / Gluconeogenesis
svl00051  Fructose and mannose metabolism
svl00562  Inositol phosphate metabolism
svl01100  Metabolic pathways
svl01110  Biosynthesis of secondary metabolites
svl01120  Microbial metabolism in diverse environments
svl01130  Biosynthesis of antibiotics
svl01200  Carbon metabolism
svl01230  Biosynthesis of amino acids
Module
svl_M00002  Glycolysis, core module involving three-carbon compounds
svl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Strvi_7032
   00051 Fructose and mannose metabolism
    Strvi_7032
   00562 Inositol phosphate metabolism
    Strvi_7032
Enzymes [BR:svl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Strvi_7032
Exosome [BR:svl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Strvi_7032
  Exosomal proteins of bladder cancer cells
   Strvi_7032
  Exosomal proteins of melanoma cells
   Strvi_7032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEM86400
UniProt: G2P8I6
Position
complement(8045220..8045996)
Genome map
AA seq 258 aa AA seqDB search
MSDRTPLMAGNWKMNLNHLEAIAHVQKLAFALTDKDYEAVEVAVLPPFTDLRSVQTLVDG
DKLKIKYGAQDISAHDSGAYTGEISGPMLAKLKCAFAVVGHSERRQYHCESDELCNAKVK
AAFRHDLTPILCVGEGLEVRKAGNQVAHTLAQVDGGLKDIPAEQAETIVIAYEPVWAIGT
GEVATPEDAQEVCGAIRGRLAELYGQEVADKVRIQYGGSVKSGNVAAIMAQPDVDGALIG
GAALDADEFVKIVRFRDQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaccgtacgccgctgatggcgggcaactggaagatgaacctcaaccacctcgag
gccatcgcccacgtccagaagctcgccttcgcgctcaccgacaaggactatgaggccgtg
gaggtcgcggtgctgccgcccttcaccgatctgcggtcggtgcagaccctggtcgatggc
gacaagttgaagatcaagtacggcgcccaggacatctccgcgcacgactccggcgcctac
accggcgagatctccggcccgatgctggccaagctcaagtgcgccttcgccgtcgtcggg
cactcggagcggcgccagtaccactgcgagtccgacgagctgtgcaacgccaaggtcaag
gcggccttccgccatgacctcaccccgatcctgtgcgtcggcgagggccttgaggtccgt
aaggcgggcaaccaggtcgcccacaccctcgcgcaggtggacggcggtctcaaggacatc
cccgccgagcaggccgagaccatcgtgatcgcctacgagccggtctgggcgatcggcacc
ggcgaggtcgcgacccccgaggacgcccaggaggtctgcggggccatccgcggccggctc
gccgagctctacggccaggaggtcgccgacaaggtccggatccagtacggcggctcggtg
aagtccgggaacgtcgccgcgatcatggcccagccggatgtggacggcgccctgatcggc
ggcgcggcgctggacgcggacgaattcgtcaagatcgttcgtttccgcgaccagtga

DBGET integrated database retrieval system