KEGG   Streptomyces violaceusniger: Strvi_7111Help
Entry
Strvi_7111        CDS       T01602                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
svl  Streptomyces violaceusniger
Pathway
svl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
svl01100  Metabolic pathways
svl01110  Biosynthesis of secondary metabolites
svl01130  Biosynthesis of antibiotics
svl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Strvi_7111
Enzymes [BR:svl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Strvi_7111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh His_biosynth
Motif
Other DBs
NCBI-ProteinID: AEM86477
UniProt: G2NW17
Position
complement(8140421..8141230)
Genome map
AA seq 269 aa AA seqDB search
MSVLDEIIDGVRADLTERQARVTLDELKERAAKARPAKDGVAALKGDSVNVICEVKRSSP
SKGALAAIADPAGLAADYEAGGASVISVLTEQRRFGGSLADLEAVRAKVDIPVLRKDFIV
TSYQLWEARAYGADVILLIVSALEQEALVSLIERAVSIGLTPLVEVHDEEEVVRAVDAGA
RVIGVNARDLKTLQVDRSTFARVAPEIPDHIVKIAESGVRGPHDLIAYANDGADAVLVGE
SLVTGRDPKAAVADLVAAGAHPALRHGRD
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgctcgacgagatcatcgacggagtccgtgccgacctcacggagcggcaggcg
cgcgtcaccctcgacgagctcaaggagcgggcggccaaggcccggccggcgaaggacggc
gtcgcggcgctcaagggcgacagcgtcaacgtgatctgcgaggtcaagcggtccagcccg
tccaagggcgcgctcgccgcgatcgccgaccccgcggggctcgccgccgactacgaggcg
ggcggcgcgtccgtcatcagcgtgctgaccgagcagcgccgcttcggcggttcgctggcc
gacctggaagccgtaagggccaaggtcgacattccggtgctccgtaaggacttcatcgtc
acctcgtaccaactgtgggaggcgcgggcgtacggcgccgacgtcatcctgctgatcgtc
tccgcgctggagcaggaggcgctggtctcgctcatcgagcgtgccgtgtccatcgggctg
acgccgctggtcgaggtgcacgacgaggaggaggtcgtccgcgcggtcgacgccggggcc
cgggtcatcggcgtcaacgcacgcgacctcaagaccctccaggtggaccgctcgaccttc
gcacgcgtcgccccggagatccccgaccacatcgtcaagatcgcggagtcgggtgtgcgc
ggtccgcacgacctgatcgcctacgcgaacgacggcgcggacgcggtgctggtcggcgag
tccctggtgaccggacgcgaccccaaggccgcggtggccgatctggtggcggcgggcgcc
cacccggcgctgcgccacggccgggactga

DBGET integrated database retrieval system