KEGG   Streptomyces violaceusniger: Strvi_7258Help
Entry
Strvi_7258        CDS       T01602                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
svl  Streptomyces violaceusniger
Pathway
svl00020  Citrate cycle (TCA cycle)
svl00310  Lysine degradation
svl01100  Metabolic pathways
svl01110  Biosynthesis of secondary metabolites
svl01120  Microbial metabolism in diverse environments
svl01130  Biosynthesis of antibiotics
svl01200  Carbon metabolism
Module
svl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
svl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Strvi_7258
  Amino acid metabolism
   00310 Lysine degradation
    Strvi_7258
Enzymes [BR:svl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Strvi_7258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding HlyD_3 GCV_H
Motif
Other DBs
NCBI-ProteinID: AEM86622
UniProt: G2P8Q7
Position
8297510..8299255
Genome map
AA seq 581 aa AA seqDB search
MAVSVTLPALGESVTEGTVTRWLKAEGERVEADEPLLEVSTDKVDTEIPAPSAGVLTSIK
VAEDETVEVGAELAVIDDGGAAPAEAPAPAAEPAPAAQPEPAPAPAAEAPAPAAAAPAGG
AQGTDVVLPALGESVTEGTVTRWLKEVGESVEADEPLLEVSTDKVDTEIPAPVAGTLLEI
LVGEDETAEVGAKLAVIGVAGAAPAAAPAPAAPAPAPVQEAPAPAPAPQAPSAPAPQAVT
PEPVAPEPAPAAPAPAPAPAATAPSIPAPAAPEAEGAYVTPLVRKLAAENNVDLSTVKGT
GVGGRVRKQDVIAAAEAAKAAAQAQAAPAAAAPKAAPQAASPLRGQTVKMPRMRKVIGDN
MMRALHEQAQLTSVVEVDVTKVMRLRAQAKEAFAQREGVKLSPMPFFVKAAVQALKAHPA
VNARINDDGTITYFDVENVGIAVDAEKGLMTPVIKNAGDLNIAGIARKTAELAGKVRSSK
ITPDEVSGATFTISNTGSRGALFDTIIVPPNQVAILGIGATVKRPVVIDHPELGETIAVR
NMTYLALSYDHRLVDGADAARYLTAVKEILETGEFEVDLGL
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atggcggtttccgtaaccctgccggcgctcggcgagagcgtgaccgagggcaccgtcacc
cgctggctcaaggccgaaggtgagcgcgtcgaggccgacgagcccctgctcgaggtgtcg
accgacaaggtcgacaccgagatcccggccccttcggccggtgtgctgacgtccatcaag
gtggccgaggacgagacggtcgaggtcggcgccgagctggccgttatcgacgacggcggc
gcggctccggccgaggcccccgcccccgcggccgagcccgctccggcggctcagcccgag
cccgccccggcgcccgccgccgaggcccctgcccctgccgccgccgctccggccggtggc
gcccagggcaccgatgtggtcctgcccgcgctgggcgagtcggtgaccgagggcaccgtg
acccgctggctcaaggaggtcggcgagtccgtcgaggccgatgagccgctgctcgaggtc
tccaccgacaaggtcgacaccgagatcccggccccggtcgcgggcaccctgctggagatc
ctggtcggcgaggacgagaccgccgaggtcggcgccaagctggccgtgatcggtgtcgcc
ggtgccgctccggccgccgcgcccgccccggccgccccggcccccgcaccggtccaggag
gccccggcgcccgccccggccccgcaggccccgagcgcccccgcgccgcaggccgtcacc
ccggagccggtcgcccccgagccggccccggccgctccggcgcccgccccggccccggcc
gcgacagccccgtcgatccctgctcccgcggcccccgaggccgagggcgcctacgtcacc
ccgctggtgcgcaagctggccgccgagaacaacgtggacctgtccaccgtcaagggcacc
ggcgtcggtggccgcgtccgcaagcaggacgtcatcgccgccgccgaggccgccaaggcc
gccgcccaggcccaggccgccccggccgccgccgcgccgaaggccgccccccaggcggcg
tccccgctgcgtggccagaccgtcaagatgccgcggatgcgcaaggtcatcggcgacaac
atgatgcgggccctgcacgagcaggcgcagctcaccagcgtggtcgaggtggatgtcacc
aaggtcatgcggctgcgcgcgcaggccaaggaggcgttcgcgcagcgcgagggcgtcaag
ctctcgccgatgccgttcttcgtgaaggccgccgtccaggcgctgaaggcccacccggcc
gtcaacgcccggatcaacgacgacggcaccatcacgtacttcgacgtggagaacgtcggg
atcgcggtggacgccgagaagggcctgatgaccccggtcatcaagaacgcgggcgacctc
aacatcgccggtatcgccaggaagacggcggagctggccggcaaggtccgctccagcaag
atcaccccggacgaggtgtccggcgccaccttcacgatcagcaacaccggctcgcgcggt
gcgctgttcgacacgatcatcgtgcccccgaaccaggtcgccatcctgggcatcggcgcg
accgtcaagcgcccggtggtcatcgaccacccggagctgggcgagaccatcgcggtgcgc
aacatgacgtacctggcgctctcctacgaccaccgcctggtggacggtgccgacgcggcc
cgctacctgacggccgtcaaggagatcctggagaccggtgagttcgaggtggacctcggt
ctctga

DBGET integrated database retrieval system