KEGG   Streptomyces violaceusniger: Strvi_8317Help
Entry
Strvi_8317        CDS       T01602                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
svl  Streptomyces violaceusniger
Pathway
svl00860  Porphyrin and chlorophyll metabolism
svl01100  Metabolic pathways
svl01110  Biosynthesis of secondary metabolites
svl01120  Microbial metabolism in diverse environments
Module
svl_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Strvi_8317
Enzymes [BR:svl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Strvi_8317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AEM87637
UniProt: G2P938
Position
complement(9573131..9574297)
Genome map
AA seq 388 aa AA seqDB search
MHREQTGPAGDEAPVGPLAGFTVGVTAARRADELGALLQRRGAAVMHAPALRIVPLADDS
ELMAATKQLIDHAPHVVIATTAIGFRGWVEAADGWGLGDALLDRLREVRLLARGPKVRGA
IRAAGLTEEWYPPSESMAEVLDRLLEEGVEGQRIAIQLHGEPLPGFVESLRAGGAEVVGV
PVYRWMPPEDIGPVDRLLDATVARALDAVTFTSAPAAASLLDRAERRGMREELLDALRHD
VLAACVGPVTALPLEAHDIPTSQPERFRLGPLVQLLTTELPGRVRPLPVAGRRLEIRGHA
VVVDGALRTVPPAGMALLRALARRPGWVVARAELLRSLPGAGRDEHAVETAMARLRTALG
SPKLIQTVVKRGYRLALDPSAETKYADA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgagaacagaccggacccgcgggcgacgaagcacccgtcggccctctcgccgga
ttcaccgtgggggtcaccgcggcacggcgcgcggatgagctcggcgcgctgctgcagcgg
cgcggcgcggccgtgatgcacgcgccggcgctgcggatcgtgccacttgccgacgactcc
gaactcatggccgccaccaagcagttgatcgaccacgccccgcatgtcgtcatcgccacc
accgccatcggcttccgcggctgggtcgaggccgccgacggctggggcctgggcgacgcg
ctgctcgaccggctgcgagaggtgcggctgctggcccgcgggcccaaggtgcgcggggcg
atccgggccgccgggctcaccgaggagtggtacccgccctccgagtcgatggccgaggtg
ctcgaccggctgctggaggagggcgtcgaggggcagcgcatcgccatccagttgcacggc
gagccgctgcccggcttcgtcgagtcgctgcgcgccgggggagcggaggtggtcggggtg
ccggtctaccgctggatgccaccggaggacatcggacccgtcgaccgactgctggacgcc
acggtcgcccgcgccctggacgccgtcaccttcaccagcgcccccgccgccgcgagcctg
ctggaccgggccgaacggcgcggcatgcgcgaggaactcctcgacgcgctccgccacgac
gtgctggcggcctgcgtcggcccggtcaccgcgctcccgctggaggcccacgacataccc
acctcccagcccgaacggttccgcctcggccccctcgtccaactgctgaccaccgaactc
ccgggccgggtccgcccgttgccggtcgccgggcggcgcctggagatccggggccacgcg
gtggtcgtcgacggcgcactgcgcaccgtgccacctgcggggatggctctgctgcgcgcc
ctggcccgccgccccggctgggtcgtggcccgcgcggaactcctgcgctccctgccgggc
gcgggccgcgacgaacacgcggtggagacggcgatggcccgcctgcgtacggcccttggc
tcccccaagctcatccagaccgtggtcaaacgcgggtacaggctggcgctggacccttcg
gccgaaacgaagtacgcggacgcgtag

DBGET integrated database retrieval system