KEGG   Streptomyces violaceusniger: Strvi_8616Help
Entry
Strvi_8616        CDS       T01602                                 

Definition
(GenBank) putative succinate dehydrogenase membrane subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
svl  Streptomyces violaceusniger
Pathway
svl00020  Citrate cycle (TCA cycle)
svl00190  Oxidative phosphorylation
svl00650  Butanoate metabolism
svl01100  Metabolic pathways
svl01110  Biosynthesis of secondary metabolites
svl01120  Microbial metabolism in diverse environments
svl01130  Biosynthesis of antibiotics
svl01200  Carbon metabolism
Module
svl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
svl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
svl_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:svl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Strvi_8616
   00650 Butanoate metabolism
    Strvi_8616
  Energy metabolism
   00190 Oxidative phosphorylation
    Strvi_8616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AEM87924
UniProt: G2P1H5
Position
9928443..9928913
Genome map
AA seq 156 aa AA seqDB search
MSAETTTPASDAVSAYDVDHPAPVIEPPRARSRKTPRATRTNFEMYGWLFMRLSGVLLVV
LVLGHLLIQLVLDGGVTKIGFAFVAGRWASPFWQAWDLIMLWLATLHGANGLRTIINDYA
ERETTRLWLKALLYTAAGFTIVLGTLVIFTFDPNIR
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgagaccaccacccccgcgagcgacgcggtcagcgcgtacgacgtggatcat
ccggccccggtcatcgagccgccgcgggcccgtagccgcaagacgcccagggcgacccgt
acgaacttcgagatgtacggctggctcttcatgcgcctgtccggcgtcctgctggtcgtc
ctggtccttggccatctgctgatccagctcgtgctggacggcggtgtcaccaagatcggc
ttcgccttcgtggccggccgctgggcctcgccgttctggcaggcatgggatctgatcatg
ctctggctcgccacgctgcacggcgcgaacggcctgcgcacgatcatcaacgactacgcg
gagcgggaaaccacccgcctgtggctgaaggcgctgctctacacagcggcaggattcacc
atcgtgctcggcactctggtgatcttcaccttcgacccgaacatccgctag

DBGET integrated database retrieval system