KEGG   Shewanella violacea: SVI_0653Help
Entry
SVI_0653          CDS       T01206                                 

Definition
(GenBank) alpha-ribazole-5'-phosphate phosphatase, putative
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
svo  Shewanella violacea
Pathway
svo00860  Porphyrin and chlorophyll metabolism
svo01100  Metabolic pathways
Module
svo_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:svo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SVI_0653
Enzymes [BR:svo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     SVI_0653
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 DUF3693
Motif
Other DBs
NCBI-ProteinID: BAJ00624
UniProt: D4ZG25
Position
788480..789103
Genome map
AA seq 207 aa AA seqDB search
MAECTTVFYLLRHGECEGGNILRGHTDVAVSQTGRASMTAAIDRLVERHEVEFDQIFSSP
LRRCSEFALNLYLKNGVPLKLEEDLKEVNFGDWDGETLESLYQHSSEMIESYWKNPWAVT
PPNGESMLGFESRVDAVWQSILQQYSGQTLLLITHAGVMRHLMANALGVSGVAGFYTQLS
LAYAAVVKISVFTSPQGHFTKLHWGND
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggccgagtgcaccactgtcttctatcttctccgtcatggcgaatgtgaaggcggaaat
atactcagaggacataccgatgtcgccgtgagtcagacgggacgagcatctatgaccgca
gccatagatcgcctcgtggagcgtcacgaggtggagtttgatcaaatattctcatccccc
ctgcgtcgctgtagtgagtttgcgcttaatctttacctgaaaaatggggtgccattaaaa
ctggaggaagatttaaaggaggttaactttggtgattgggatggtgagaccctagagagc
ctgtatcagcactcatctgagatgatagagagctactggaaaaatccctgggccgtgacg
ccgccgaatggcgagagcatgcttgggtttgaatccagagtcgatgcagtgtggcaatct
attctgcagcaatatagtggacagaccttactcttgatcacccacgccggggtaatgaga
cacttgatggccaatgcccttggcgtgagtggcgtcgcagggttttatactcaactgtca
ttggcttatgctgctgtggttaaaatatctgtatttacctcgccccaaggccacttcact
aagctgcactggggcaatgactag

DBGET integrated database retrieval system