KEGG   Shewanella violacea: SVI_0876Help
Entry
SVI_0876          CDS       T01206                                 

Definition
(GenBank) 1,4-beta-cellobiosidase, putative
  KO
K19668  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
svo  Shewanella violacea
Pathway
svo00500  Starch and sucrose metabolism
svo01100  Metabolic pathways
svo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:svo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SVI_0876
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SVI_0876
Enzymes [BR:svo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     SVI_0876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_6 CBM_2 PKD PKD_3
Motif
Other DBs
NCBI-ProteinID: BAJ00847
UniProt: D4ZGP8
Position
complement(1021478..1023688)
Genome map
AA seq 736 aa AA seqDB search
MRSGLIKGVTLTSMLLATLQANAAVKCDYSIENEWETGFVGAIQLKNTGETLIDGWQVSW
QYLDGSTVSSAWNSTFSGNSPYLASNLVWNNLIQPGETITFGIQGEKGIPNKAASTPKIS
GEICTREANNSAPMTSFTIIESGLDISFDASATRDADGDELTYSWDFGDETLGEGVNTEH
SFSSLGSYIVTLTVSDGLVIDEHSIELNIKSLVPNQAPLASFNTIHDGLALSFNASNSSD
PEGDALSYLWSFGDGTSQSGINTYHQYAAHGLYTVTLNVSDGSSNTQIRTELLVTYDGAT
GQHVANPFLGTTSYINPDYAKFVDASMALESAPHLQAKMAQVKQQATAVWLDRIDAIYGG
EINSGRLSLEQHFDNALAQKRVGVPITVSIVVYNLPDRDCAALASNGTLNAAEGGLEIYK
HDYIDTIANIAAAPRFEDLRIIAVIEPDSLPNLVTNTRVLKCGIVNSNGTYVEGVQYALS
RFSRLDNVYSYLDIAHSGWLGWDTNMRGAIDLYTSVVAGVADGDMSVLDGFISNVANYTP
AEEIFLPDPEFDFDGDFMGIKSSSYYEWNPVFDEKDFAQSLHAEFVAKGFPTSLAMLIDT
SRNGWGASDRPTSPNEDASNEDQYVMDSKLDRRAHRGNWCNSSGAGIGARPETLPFGSTS
VIQAYVWIKPPGESDGTSDASQTTPDEEGKSFDPMCSPEFTTSGGVLTGAMNGAPSAGAW
FHEQFKMLVENAHPEL
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgagatctggcttaataaagggagtgacgctcacaagcatgttactggctacgctccaa
gctaatgcagctgttaagtgtgattattctattgaaaatgagtgggaaacaggttttgtt
ggtgcaatacagcttaaaaacaccggcgaaactctcattgatggctggcaagtaagctgg
caatacctagatggctccacagtttcatcagcatggaactcaaccttttccggtaatagc
ccctatttggccagtaacctagtgtggaataatctaatccaacccggagagacgattaca
tttggcattcaaggtgagaaaggcatccccaacaaagctgcttcaacgcccaaaatatct
ggagaaatttgcactagagaagctaataacagcgcgccaatgactagtttcactattata
gaatcgggtttggatatcagcttcgatgcctctgcgacccgtgatgccgatggtgacgaa
ttgacctacagctgggattttggggatgaaaccttaggtgaaggtgttaacacagagcat
tcattctcaagccttggtagttacatcgtcaccttaactgtcagtgatggactcgtcatt
gacgaacatagcattgaattaaatattaaaagcctagtgcctaaccaagctcctcttgct
agtttcaacaccattcatgacggattagccctctcctttaatgccagtaactcaagtgat
ccagaaggtgatgcactcagttatttatggtcctttggtgatggcacatctcaatcgggt
attaatacttaccaccaatatgcagctcatggtctttataccgtaaccttgaatgtttcc
gatggtagcagcaatacccaaatcagaactgaacttctagtgacctatgatggcgccaca
ggtcaacacgttgccaaccccttcctcggaaccaccagctacataaaccctgattatgcc
aagtttgtcgatgcatctatggcattagagtccgctcctcatttacaagccaagatggct
caagttaaacaacaagcgactgcagtttggttagacagaattgatgctatctatggcgga
gagatcaacagtgggcgtctaagtttagagcagcatttcgacaatgctttggctcagaaa
cgtgtcggcgtacctattacagtctcaattgttgtttataacttacctgacagagattgc
gccgccctagcctcaaatggcaccttaaacgcggccgaaggcgggcttgaaatttataaa
cacgactatattgacactatcgctaatatcgccgccgctccccgcttcgaagacctacgt
atcatcgcagtgattgagcctgattcactgcccaacctagtgactaatacccgagtgttg
aaatgtggaatcgtcaacagtaatggtacttatgttgagggcgtgcaatatgcgttatcg
cgcttttctcggctcgataatgtctatagctatttagatatagctcactcgggttggtta
ggttgggataccaatatgcgcggagcaatcgacctgtataccagtgtagttgcaggtgtt
gcagatggcgacatgtccgtactcgatggatttatctcaaatgtagcgaactacaccccg
gcagaagagatatttttacccgacccagagtttgattttgatggtgacttcatgggaatt
aaatccagcagttactacgagtggaatccggtatttgatgaaaaagatttcgctcaatcc
ctacacgcagaatttgtcgccaaagggtttccaacaagcttagccatgctgatcgacacc
tcacgtaatggttggggcgcatccgatagaccaacctcccctaacgaagatgccagcaat
gaagatcaatatgtcatggatagtaagctagaccgccgtgcccatcgaggtaattggtgc
aactcaagcggagcaggaataggggctagacctgaaactctcccatttggtagcactagt
gtgattcaggcttatgtgtggataaagcctccaggggagtctgatggtaccagcgatgca
tctcaaaccactcccgacgaggaaggaaaaagcttcgatcccatgtgcagcccagaattt
accacctccggcggcgtgttaaccggtgccatgaatggagcaccatctgctggtgcctgg
ttccatgagcaatttaaaatgctggtagaaaatgctcatccagagctttag

DBGET integrated database retrieval system