KEGG   Shewanella violacea: SVI_0945
Entry
SVI_0945          CDS       T01206                                 

Definition
(GenBank) HlyD family secretion protein
  KO
K11003  hemolysin D
Organism
svo  Shewanella violacea
Pathway
svo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:svo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SVI_0945
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:svo02000]
    SVI_0945
   02044 Secretion system [BR:svo02044]
    SVI_0945
Transporters [BR:svo02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   SVI_0945
Secretion system [BR:svo02044]
 Type I secretion system
  alpha-Hemolysin/cyclolysin transporter
   SVI_0945
SSDB
Motif
Pfam: HlyD_3 Biotin_lipoyl_2 HlyD_D23 HlyD Biotin_lipoyl
Other DBs
NCBI-ProteinID: BAJ00916
UniProt: D4ZGW7
Position
1100244..1101653
AA seq 469 aa
MSAWGILKDAWKNRDKLGDGNTSRDLAAFLPAALEIQETPPNPLARKLGWSLLVLLVIAI
IWACLGEVNIVASAEGKIIPSSKVKLIQPLEKSVVKNILVREGQYVHKGQLLIELDSTLT
TADEKRLSGELHSARLSLAGSQALLVMLTQDANDTNIALASLAFPNVPNASQIELDLHKR
LLWQQWLQFRAQWQMLQSNLLQKQAEQAASNEVIAKLEQILPIITKRANTMKGLHSQNYA
SENDYLALEQERIQYTHDLAAERQRLKQLQASESEVRQQLNTLKAQTSVTELTKIPQIQQ
QIASLKEELAKAVDRNSKQVLYAPVSGQVQELSIGTVGGVVTEAQQLMLIVPDEVQLDVE
VFLENKDIGFVREQMLAEIKIHTFPFTKYGIIDGEVISISDDATVDEQRGLIYGMRLKMK
QSTIMVDGKEIKLMPGMAVTAEVQTGKRRIIEFFMAPLLRYRQESIRER
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgagtgcctggggaatactaaaagatgcatggaaaaatcgtgacaagttgggcgatggc
aatactagtcgagacttagccgcgtttctacctgcagcgcttgaaattcaagaaacaccg
ccaaacccgcttgcgcgtaagttaggctggagtttgcttgttcttctggttattgcaatt
atttgggcctgtttaggtgaggtcaatattgtcgcctcggctgaaggtaaaattatccca
agttctaaagtgaagttgatccagcctttagaaaaatcggtagtgaaaaacatcttagta
cgtgaaggccaatatgtgcacaaaggtcagctactaattgagttagacagcaccttaaca
accgccgatgagaagcgcctaagtggtgaactgcacagtgctcgtctgagcctagcgggt
agtcaagcgctgttagttatgctaacgcaagatgccaatgacaccaatatagctttagct
tcactggctttccccaatgtgcctaatgcgtctcaaatcgaactcgatctacataagcgg
cttttgtggcagcaatggctgcaatttcgcgcccaatggcagatgctgcagagtaatctt
ttgcaaaaacaagcagagcaagctgccagtaatgaggtgatagctaagctcgaacaaata
ttgcctattatcactaagcgtgctaacacaatgaagggcttgcacagtcaaaattatgct
tcggaaaacgactatttagcactcgagcaagagcgcattcaatacactcacgacttagcc
gccgagcgccagagacttaagcaattacaagcatcagaatcggaagtcagacagcaactt
aacactttaaaggcgcagacttcggtcaccgagttgaccaaaataccgcagatccaacaa
caaatagcctcgttgaaagaggagttggccaaggccgtcgatcgtaatagtaaacaggtt
ttatatgcgccagtgtctggccaagtgcaagagttaagcatagggaccgtaggtggagtg
gtgaccgaagcgcagcagctcatgttaatcgtacctgatgaagtgcaactcgatgtcgaa
gtgttcttagagaataaagacattggtttcgtacgcgagcagatgctagccgagataaaa
attcataccttcccctttactaaatacgggattattgatggtgaagtgatctcgatatca
gatgacgccaccgtcgatgagcagcgcggcttaatctatggtatgcgcctcaaaatgaaa
cagagcaccatcatggttgatggcaaagagataaagctgatgcccggtatggctgttacc
gccgaagtacaaacgggcaagcgacgaattatcgagttctttatggcgccgttacttagg
tataggcaagagagtattagggaacgttaa

DBGET integrated database retrieval system