KEGG   Shewanella violacea: SVI_0989Help
Entry
SVI_0989          CDS       T01206                                 

Gene name
xfp
Definition
(GenBank) D-xylulose 5-phosphate/D-fructose 6-phosphate phosphoketolase
  KO
K01621  xylulose-5-phosphate/fructose-6-phosphate phosphoketolase [EC:4.1.2.9 4.1.2.22]
Organism
svo  Shewanella violacea
Pathway
svo00030  Pentose phosphate pathway
svo01100  Metabolic pathways
svo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:svo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SVI_0989 (xfp)
Enzymes [BR:svo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     SVI_0989 (xfp)
    4.1.2.22  fructose-6-phosphate phosphoketolase
     SVI_0989 (xfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: XFP_N XFP XFP_C Transket_pyr
Motif
Other DBs
NCBI-ProteinID: BAJ00960
UniProt: D4ZH11
Position
complement(1152926..1155304)
Genome map
AA seq 792 aa AA seqDB search
MGFFMSTQQEIGALKKFVRATNFLATSQIYLKQNVLHKRALAHTDIKPRLLGHWGTCPGI
NFVYANINRLIVKNNRSFVYLVGPGHGFPAVQANLFMEGSLSHFYPETIPYNEEGISDIC
RKFSAAYGYPSHANPEAPGQILEGGELGYSLSVAWGSVLDNPDLIAACLIGDGESETGPL
AASWYANRLVDPATNGAVLPIVHINGYKISGPTRMGRMSHEELDLEFRGLGYHPIIVDDQ
LEEDVYVQMLNAMDTSYDMITEIQQRARSGEDVVKPRWPVILMRTAKGWTGTAQYNGKKL
EGNCESHQVIVNKCATDKGHLDALDTWLASYKFHELYSINDKGELIFDQEIQSLLPPKQL
TCGQQHLSYGGEVVRALTNPDLSKLAYGAETPRGHRGHSMYKMGEWMRDAMKLNRDQRNL
RIFSPDETYSNQLQAVFEETNRAWQWPIEEWDQDMARDGRVIELLSENLLFGMMHGYTVT
GRHAMFPTYESFSQVVSSMADQYCKYVYASQGVHFRKPVPACNVVLSSLLERQDHNGYSH
QNPSFLGAMLEKHPKIISAYLPADGNSTLVYTERAYADRDKLNIIVAGKKDLPQWLTLDE
ARQQAKDGVMIWDFASDDNPDVVLVGCGDYVTQEAMAALVLIREILPRVRIRFVSVTELT
SSGLGSLDFQSKPWLMDEVFTSDKGVIFNYHGYPNTIKKLVFDYKGNRRFRIKGYEEEGS
TTTPFDMGVRNGTSRYHLVIDMAYKLFQQDVIDETQHVTITTDMLQRLVEHRNYIKANGV
DPISLENWIWTR
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atggggttttttatgtcaacacaacaagagatcggcgcattaaagaagtttgtaagagcg
acgaactttctggcaacgtcacagatttacttgaaacaaaatgtactgcataaacgtgca
ctcgcacatacagatattaaacctaggctattaggtcactggggaacttgccctgggatc
aacttcgtttatgccaatatcaaccgtcttatcgttaagaataatcgctcattcgtttat
ttagtcggcccaggacatggttttccagcggtacaagctaacttgtttatggaaggctct
cttagccacttctacccggaaactattccctacaatgaagaaggtatctcagatatctgt
cggaagttttctgccgcctatggttacccttctcacgcaaaccctgaagcgccaggacaa
atcctggaaggtggcgagctcggttattcgctctcagtagcctggggatccgtgctggat
aatccagatttgattgcggcctgccttattggtgatggcgaatctgaaaccggtcccctt
gccgcttcctggtatgccaaccgtttagtcgacccagccactaacggcgctgtactacca
atcgttcatatcaacggttataagatctccggcccgactcgtatgggtcgcatgagccat
gaagagttagatctcgaattccgtggcctaggttatcacccaatcatagttgacgatcaa
ctcgaagaagatgtctatgtgcagatgctcaatgccatggacacctcttatgacatgatc
accgagattcagcagcgcgcgcgcagcggtgaagatgtagttaaacctcgctggccagtg
atcttgatgcgtaccgctaaaggttggactggtactgcacagtacaacggcaagaagctt
gagggtaactgtgaatctcatcaggttatcgtcaacaagtgtgccaccgataagggtcat
ctagatgcgctcgatacctggttagccagctacaagttccatgaactttattcgattaac
gataaaggcgagctaatattcgaccaagagatccagagcctacttccccctaaacagcta
acttgtggtcagcaacacttaagctacggtggtgaggtggttcgcgcactgactaaccca
gatctatctaagctagcctacggcgcagaaacccctagagggcatcgtggtcactccatg
tataagatgggagagtggatgcgcgatgcgatgaaactcaaccgagatcaacgcaactta
cgtatctttagtccagatgaaacttactcaaaccagcttcaggctgtgttcgaagaaacc
aaccgtgcctggcagtggcccatcgaagagtgggatcaagacatggcccgtgatggtcgt
gtcatagagctactatcagagaatctactcttcggtatgatgcatggctatacagtgacg
ggccgtcacgccatgttccctacctatgagtcattctctcaagtcgtctcctctatggct
gaccaatattgtaaatatgtctatgccagtcagggcgttcatttccgtaaacctgtacct
gcgtgcaacgtggtactctcctcactgctggagcgccaggatcacaacggttattcgcat
cagaacccatcattcttaggcgctatgcttgagaagcatccgaagatcatctcagcctac
ctgcctgccgacggtaacagcactttagtctacacggaacgcgcctatgctgaccgtgat
aaattaaacatcatagttgccggcaagaaagatctgccacaatggctaacactcgatgaa
gcacgccagcaagcgaaagatggtgtgatgatttgggattttgcctctgacgacaaccct
gatgtggttctggttggttgtggtgattacgtcacccaagaagccatggcagctctggta
ttgatcagagagatactccctcgcgttcgaattcgtttcgtcagcgtcaccgaactcacc
agtagcggtcttggtagcttagatttccaaagtaaaccttggttaatggatgaggtgttc
acctcagacaagggggttatcttcaattaccacggctacccaaataccatcaagaagttg
gtatttgattataaaggtaatagaagattcagaatcaagggttatgaagaggaaggttca
accactaccccattcgatatgggtgtcagaaacggaacctcacgctaccatctcgttatc
gatatggcctacaagctattccagcaagatgtcatcgatgagacacaacatgtcaccatc
accacagatatgctgcaacgtctggtagaacacagaaattatatcaaggccaacggtgtc
gatcctatcagtttagaaaactggatctggaccaggtaa

DBGET integrated database retrieval system